KEGG   Saccharomonospora viridis: Svir_32560Help
Entry
Svir_32560        CDS       T00980                                 

Definition
N-acetyl-beta-hexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
svi  Saccharomonospora viridis
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:svi00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Svir_32560
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Svir_32560
Enzymes [BR:svi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Svir_32560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3535873..3537450
Genome map
AA seq 525 aa AA seqDB search
MLAAVACAAALAVSAAPAAADPSVTTTTDIGLGDVIPVPAEVTPDPDADYRLGPGTLIRT
EPRSDEVRAIGHQLADALRPATGYPLPVVPARGNGGGISLLLDDVGDELGPEGYRLDVTK
RGVTIRANEPAGLFAGTQTLRQLLPAAIESDTPQHKTWTVPGGGIVDHPRFSYRSAMLDI
ARHFHTLDEIKSYIDEIARYKINHLHIHLTDDQGWRIEIESWPELATVGGGPGTGVDGVG
GGYLTKDDYRDIVSYAAERYITVVPEIDMPGHTNSALSTYAELNCDGIAPPPRTDIEVGY
SSLCIDKEITYEFVDDVIREIAELTPGPYLHIGGDEAWSTPPEDYRTFMQRVVPIVEKYG
KRPLGWNEIVRGTPSTDTIAQYWGTTTEHEEIADAVARGHKVIMSPADKAYIDMKYDENT
PLGLSWAGYIEVRDAYDWDPGDHVSGVGEDAVLGVEAPLWSETLRTLDHIEYMAFPRLAA
IAELGWSPRDTHDWTSFSERLSKQGPRWEARGVDFYRSPQVPWGS
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgctcgccgccgtggcgtgcgccgcggcactggcggtgtcggcggcacccgcggcagcg
gacccgtccgtgaccaccacgaccgacatcggcctcggcgacgtcatccccgtcccggcc
gaggtgacccccgatccggacgccgactaccggctcgggccggggacgctcatccgcacg
gaaccacggtcggacgaggtgcgggccatcggccaccagctcgccgacgcactacgtccc
gccaccggctacccactaccggtggtccccgcacgcggcaacggcggcggcatctcactg
ttgctcgacgacgtgggcgacgaactcggccccgagggataccgactggacgtcaccaaa
cgcggtgtcacgatccgggccaacgaaccggcgggacttttcgccggcacccagacgctg
cgccagttactgcccgccgcgatcgaatccgacacaccccagcacaagacgtggaccgtg
cccggcggcggcatcgtcgaccacccacggttctcctaccgcagcgccatgctcgacatc
gcgcgccacttccacacgcttgatgagatcaagtcctacatcgacgaaatcgcgcgctac
aagatcaaccacctgcacatccacctgacggacgaccagggctggcgcatcgagatcgaa
agctggcccgaactcgccaccgtgggcggtggaccgggcaccggtgtcgacggtgtgggc
ggcggttacctcaccaaggacgactaccgcgacatcgtctcctacgccgccgagcggtac
atcaccgtcgtcccggagatcgacatgccgggacacaccaactccgcgctgtccacgtac
gcggaactgaactgcgacggcatcgccccgccaccgcgcaccgacatcgaggtcggctac
agctccctgtgcatcgacaaggagatcacctacgagttcgtggacgacgtcatccgtgag
atcgcggaactgacgcccggaccgtacctgcacatcggcggggacgaggcatggtcgacg
ccgccggaggattaccgcacgttcatgcagcgcgtggtgccgatcgtggagaagtacggc
aaacgtccgctcggctggaacgagatcgtgcggggcacaccctccaccgacaccatcgcc
cagtactggggcaccacgaccgaacacgaggagatcgccgacgccgtcgcccgcggccac
aaggtgatcatgtcgcccgccgacaaggcctacatcgacatgaagtacgacgagaacacg
ccactcggtctgtcctgggcgggctacatcgaggtgcgcgacgcctacgactgggacccc
ggtgaccatgtcagcggggtcggcgaggacgccgtgctgggcgtggaggcaccactgtgg
tcggagacgctgcgcacgctcgaccacatcgagtacatggcgttcccgcggctggccgcc
atcgccgaactcggctggtcgccgcgggacacgcacgactggacgtcgttcagcgaacga
ctcagcaagcaggggccgcgttgggaggcccgcggcgtcgacttctaccgctcaccgcag
gttccgtgggggtcgtga

DBGET integrated database retrieval system