KEGG   Saccharomonospora viridis: Svir_32670Help
Entry
Svir_32670        CDS       T00980                                 

Definition
UDP-glucose pyrophosphorylase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
svi  Saccharomonospora viridis
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:svi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Svir_32670
   00052 Galactose metabolism
    Svir_32670
   00500 Starch and sucrose metabolism
    Svir_32670
   00520 Amino sugar and nucleotide sugar metabolism
    Svir_32670
Enzymes [BR:svi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Svir_32670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3549103..3550005)
Genome map
AA seq 300 aa AA seqDB search
MTGATNETTFRTAIVPAAGLGTRFLPTTKAVPKELLPVVDTPGIELVASEAAEAGAQRMV
IVTSPEKKSVVSYFDEKPELEAALERKGKTGLLEKVRRAPGLLKVEVAIQEEALGLGHAV
AQAEPNLDDDETAVAVLLPDDLVLPTGVLSKMADVRARYGGSVLCAFDIPKEHISPYGVF
EVSDTDDDDVKRVHGMVEKPTPEEAPSTYAAAGRYLLDRAIFDALQRIGPGSGGELQLTD
AVALLISEGHPVHVVVHHGGRHDLGNPGGFVRATVDFALDHPEYGPSLREWLIERIGTTD
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgacgggcgccacgaatgagaccacgttccggaccgccatcgtgcctgccgcgggcctc
ggcacgagattcctaccgaccaccaaggcagtgccgaaggagctgcttcccgtcgtcgac
accccgggtatcgagttggtcgcgagcgaggccgccgaggcgggcgcgcagcgcatggtg
atcgtcacatcccccgagaagaagtcggtcgtcagctacttcgacgagaagcccgagctg
gaggccgcgctcgaacgcaagggcaagaccggtttgctggagaaggtccgccgggccccg
ggcttgctcaaggtggaggtggcgattcaggaggaggcgctcggtctcggccacgccgtc
gcgcaggccgagccgaacctcgacgacgacgaaaccgccgtggccgtcctcctccccgac
gacctcgtgctgcccaccggcgtgttgtcgaagatggcggatgtgcgcgcccggtacggc
ggcagcgtgctgtgcgcgttcgacataccgaaggagcacatctcgccgtacggcgtgttc
gaggtgtccgacaccgatgacgacgacgtcaagcgggtccacggcatggtggagaagccc
acccccgaggaggcgccctccacgtacgcggcggcgggtcgctacctactcgatcgggcg
attttcgacgcgctgcagcgcatcggacccgggtccggtggggagctccagctcaccgac
gccgtcgcgctcctgatctccgagggacatccggttcacgtcgtggtgcaccacggtggg
cggcatgacctcggtaaccccggtggcttcgtccgcgccaccgtggatttcgcattggat
caccctgagtacggcccctcgcttcgcgagtggttgatcgaacggatcggcaccaccgac
tga

DBGET integrated database retrieval system