KEGG   Saccharomonospora viridis: Svir_32670Help
Entry
Svir_32670        CDS       T00980                                 

Definition
UDP-glucose pyrophosphorylase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
svi  Saccharomonospora viridis
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:svi00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:svi00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:svi00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:svi00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3549103..3550005)
Genome map
AA seq 300 aa AA seqDB search
MTGATNETTFRTAIVPAAGLGTRFLPTTKAVPKELLPVVDTPGIELVASEAAEAGAQRMV
IVTSPEKKSVVSYFDEKPELEAALERKGKTGLLEKVRRAPGLLKVEVAIQEEALGLGHAV
AQAEPNLDDDETAVAVLLPDDLVLPTGVLSKMADVRARYGGSVLCAFDIPKEHISPYGVF
EVSDTDDDDVKRVHGMVEKPTPEEAPSTYAAAGRYLLDRAIFDALQRIGPGSGGELQLTD
AVALLISEGHPVHVVVHHGGRHDLGNPGGFVRATVDFALDHPEYGPSLREWLIERIGTTD
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgacgggcgccacgaatgagaccacgttccggaccgccatcgtgcctgccgcgggcctc
ggcacgagattcctaccgaccaccaaggcagtgccgaaggagctgcttcccgtcgtcgac
accccgggtatcgagttggtcgcgagcgaggccgccgaggcgggcgcgcagcgcatggtg
atcgtcacatcccccgagaagaagtcggtcgtcagctacttcgacgagaagcccgagctg
gaggccgcgctcgaacgcaagggcaagaccggtttgctggagaaggtccgccgggccccg
ggcttgctcaaggtggaggtggcgattcaggaggaggcgctcggtctcggccacgccgtc
gcgcaggccgagccgaacctcgacgacgacgaaaccgccgtggccgtcctcctccccgac
gacctcgtgctgcccaccggcgtgttgtcgaagatggcggatgtgcgcgcccggtacggc
ggcagcgtgctgtgcgcgttcgacataccgaaggagcacatctcgccgtacggcgtgttc
gaggtgtccgacaccgatgacgacgacgtcaagcgggtccacggcatggtggagaagccc
acccccgaggaggcgccctccacgtacgcggcggcgggtcgctacctactcgatcgggcg
attttcgacgcgctgcagcgcatcggacccgggtccggtggggagctccagctcaccgac
gccgtcgcgctcctgatctccgagggacatccggttcacgtcgtggtgcaccacggtggg
cggcatgacctcggtaaccccggtggcttcgtccgcgccaccgtggatttcgcattggat
caccctgagtacggcccctcgcttcgcgagtggttgatcgaacggatcggcaccaccgac
tga

DBGET integrated database retrieval system