KEGG   Saccharomonospora viridis: Svir_33400Help
Entry
Svir_33400        CDS       T00980                                 

Definition
agmatinase (EC:3.5.3.22)
Orthology
K12676  
proclavaminate amidinohydrolase [EC:3.5.3.22]
Organism
svi  Saccharomonospora viridis
Pathway
Clavulanic acid biosynthesis
Biosynthesis of secondary metabolites
Module
Clavaminate biosynthesis, arginine + glyceraldehyde-3P => clavaminate
Brite
KEGG Orthology (KO) [BR:svi00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00331 Clavulanic acid biosynthesis
    Svir_33400
Enzymes [BR:svi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.22  proclavaminate amidinohydrolase
     Svir_33400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3634079..3635110
Genome map
AA seq 343 aa AA seqDB search
MNEVPERVRATSSPRYAQVATYMRLPLVPKAVGYDVAVIGAPYDGGTSYRPGARLAPRAI
RHESCLIHGTGIDRGPNIFDVLDVVDAGDLDLSPFSMELAIETATQALTELLQDNDAFLM
FGGDHSLSLPGMRAAYAKHGPLAVLHLDAHSDTFPPVYGGLHHHGTPFRWGLDEGLIDPH
SMIQIGIRGHNPSPDSLDYPRGRGVTVVTAQECEGPDAVERLTQLIREVAGDRPLYVSVD
VDVVDPAFAPGTGTPAPGGLTSRELLGLLNAVGDLNPVAFDVMEVCPPFDHSGITALLAA
EVGAELLYQYLRAHRGDSTVRPTFSRTNVTNGATFPTESKGKP
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaggttcccgaacgcgtccgcgccaccagctccccccgttacgcgcaggtggcg
acgtacatgcggctgcccctggtgccgaaggccgtgggatacgacgtcgccgtcatcggc
gccccctacgacggcggcaccagctaccgtccgggagcccgactcgcccctcgggccatc
cgacacgagtcatgcctgatccacggcacgggcatcgaccgcggaccgaacatcttcgac
gtgctcgacgtcgtcgacgcgggtgacctggacctaagcccgttctcgatggaactggcg
atcgaaacggccacgcaagctctgacggagttgctgcaggacaacgacgcgttcctcatg
ttcggcggggaccactcgctgtcgctgccgggaatgcgcgcggcctacgccaagcacggg
ccgctggctgtgctgcatttggacgcacacagtgacaccttcccgccggtgtacgggggt
ttgcaccaccacggaaccccgttccggtggggactcgacgaggggttgatcgacccccac
agcatgatccagatcggcattcgcggacacaacccgagcccggactcgttggactaccca
cgcggccgcggcgtcaccgtggtgacggcccaggaatgcgagggcccggacgccgtcgaa
cgactcacccaactgatccgcgaggtggccggggacaggccgctgtacgtgtcggtcgac
gtggacgtcgtcgaccccgccttcgccccgggcacgggcactccggcccccggagggttg
acctcccgggaactgctcggcctgctcaacgcggtcggggacctgaatccagtggccttc
gatgtgatggaggtgtgcccaccgttcgaccattcaggcatcaccgcgctgctcgccgct
gaggtcggcgccgaactgctttaccagtacctgcgggcgcaccggggtgactccacggta
cgcccgacgttctccaggaccaatgtgaccaacggggcgacgttccccacggagtcgaaa
ggaaagccgtga

DBGET integrated database retrieval system