KEGG   Saccharomonospora viridis: Svir_35610Help
Entry
Svir_35610        CDS       T00980                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
svi  Saccharomonospora viridis
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:svi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Svir_35610
Enzymes [BR:svi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Svir_35610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3879623..3880114)
Genome map
AA seq 163 aa AA seqDB search
MSRAVLSLGSNLGDRVGYLRLAVDGLRDVLVAVSSVYETKPWGVTDQPDFLNAVCIVDDP
ARDHWAWLRTAQELERRAQRVRERRWGPRTLDVDVVTVDAVRSDDPELLLPHPGAHERST
VLIPWLEIDPDAEVPGRGRAADLLAALDEDDRAGVRLRADVVL
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgagcagggcggtgttgtccctcggatccaatctgggtgaccgggtcggctatctgcgg
ctggccgtggacggattgcgggacgtgctggtggccgtctcgtcggtgtacgagacgaag
ccgtggggcgtgaccgaccaaccggatttcctcaacgccgtgtgcatcgtcgacgacccc
gcccgggaccactgggcgtggctgcggacggcgcaggagttggagcgcagggcccagcgg
gtgcgggaacgccgctgggggccacgcacgctcgatgtcgacgtggtcacggtggacgcg
gtgcgttccgacgacccggagttgctgctgccccaccccggcgcacatgagcgttcgacg
gtgctgatcccgtggttggagatcgatcccgacgccgaggtgccgggtcggggtagggca
gccgatctgctcgccgcgctcgacgaggacgaccgtgcgggcgtgcgcctccgtgctgac
gtggtgttgtga

DBGET integrated database retrieval system