KEGG   Saccharomonospora viridis: Svir_35630Help
Entry
Svir_35630        CDS       T00980                                 

Definition
(GenBank) Dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
svi  Saccharomonospora viridis
Pathway
svi00790  Folate biosynthesis
svi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:svi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Svir_35630
Enzymes [BR:svi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Svir_35630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: ACU98519
UniProt: C7MQJ2
Position
complement(3880528..3881376)
Genome map
AA seq 282 aa AA seqDB search
MSHAVLPDPGRCVVMGILNVTPDSFSDGGRYLSREDALAHAHAMWRRGADIIDVGGESTR
PGSERVDAETEKSRVVPVVRTLAAEGLVLSVDTTRAAVAAAAIEAGAHIINDVSGGLADP
DMARVAADTGVPWVLMHWRGHSKNMNALATYDDVVSEVRSELSARVDAALAAGVREEAIV
LDPGLGFAKRAEHDWALLHGLDAVTSLGFPVLVGASRKRFLGRLLADEDGTPRAPAGREV
ATAAVSALAAYRGAWGVRVHDVGASLDAVLVGEAWRSGRAPG
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgagtcacgcggtgctgcccgatccgggccgatgcgtggtgatgggcatcctcaacgtc
acgcccgactcgttctccgacggcgggcggtacttgagccgcgaggatgccctcgcgcac
gcgcacgcgatgtggcgccggggcgcggacatcatcgatgtcggtggcgagtcgacccgg
cccgggtccgagcgggtggacgccgagacggagaagtcccgcgtggtgccggtggtacgg
acgttggccgccgaaggactggtgttgtcggtggacaccacgcgtgccgccgtcgcggcc
gccgcgatcgaggcgggtgcgcacatcatcaacgacgtgtcgggcggtcttgccgacccg
gacatggccagggtggccgccgatacgggagtgccgtgggtactcatgcactggcgcggc
cacagcaagaacatgaacgctctggccacctacgacgacgtggtgtccgaggtccgaagt
gagctgagtgcccgggtggacgcggccctcgcggcgggggtgcgggaggaggccatcgtg
ctcgacccgggcctgggtttcgccaaacgggccgagcacgactgggcgttgttgcacggt
ctcgacgcggtgacgtcgctcggtttcccggtgctggtgggggcttcgcggaaacggttc
ctcgggcgcttgttggcggacgaggacggcacaccgagggccccggcggggcgggaggtg
gcgacggccgccgtctcggccttggccgcgtaccggggtgcgtggggtgtgcgggtgcat
gacgtgggtgcgtcgttggacgcggtactggtcggggaggcgtggcggagtggtcgggcc
ccaggatga

DBGET integrated database retrieval system