KEGG   Saccharomonospora viridis: Svir_36550Help
Entry
Svir_36550        CDS       T00980                                 

Definition
(GenBank) DNA replication and repair protein RecR
  KO
K06187  recombination protein RecR
Organism
svi  Saccharomonospora viridis
Pathway
svi03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:svi00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Svir_36550
DNA repair and recombination proteins [BR:svi03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     Svir_36550
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Svir_36550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim HHH HHH_5 Toprim_2 PHF5 HHH_8 HHH_3
Motif
Other DBs
NCBI-ProteinID: ACU98607
UniProt: C7MR21
Position
complement(3976831..3977427)
Genome map
AA seq 198 aa AA seqDB search
MYEGVVQDLIDELGRLPGIGPKSAQRIAFHLLASDPADLARLQEVLGKVREGVRFCEVCG
NVSERERCRICSDPRRDTSVICVVEEPKDVLAVERTREFRGRYHVLGGALDPLSGVGPDQ
LRIKELLSRIGADEVSEVIIATDPNTEGEATATYLVRMLKDFPGLTVTRLASGLPMGGDL
EFADELTLGRALSGRRAL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
gtgtacgagggcgtcgttcaagatctgatcgatgagctcgggcggctgcccggcatcggt
cccaaaagcgcacaacgcatagcgttccatctgctggcctccgacccggcggacctcgct
cggctgcaggaggtgctcggcaaggtgcgcgagggtgtgcgtttctgcgaggtgtgcggc
aacgtctccgagagggagcgttgccgcatctgctccgacccgcgtcgggacacgagcgtc
atctgcgtggtcgaggagccgaaggacgtgctcgcggtggaacgcacccgcgagttccgg
ggccggtaccacgtgctgggcggtgcgctcgaccccctgtccggggtgggaccggaccag
ctgcggatcaaggagctgttgtcccgcatcggtgccgacgaggtgtcggaggtcatcatc
gccaccgacccgaacaccgagggggaagccacggcgacgtacctggtgcggatgttgaag
gacttcccgggactcacggtgacccgattggcgtccggtctgccgatgggcggtgacctg
gagttcgccgacgagctcacgctcggacgggcgctgtccggccgccgtgccctctga

DBGET integrated database retrieval system