KEGG   Saccharomonospora viridis: Svir_38880Help
Entry
Svir_38880        CDS       T00980                                 

Definition
(GenBank) pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
svi  Saccharomonospora viridis
Pathway
svi00010  Glycolysis / Gluconeogenesis
svi00020  Citrate cycle (TCA cycle)
svi00620  Pyruvate metabolism
svi01100  Metabolic pathways
svi01110  Biosynthesis of secondary metabolites
svi01120  Microbial metabolism in diverse environments
svi01130  Biosynthesis of antibiotics
svi01200  Carbon metabolism
Module
svi_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:svi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Svir_38880
   00020 Citrate cycle (TCA cycle)
    Svir_38880
   00620 Pyruvate metabolism
    Svir_38880
Enzymes [BR:svi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Svir_38880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H HlyD_3
Motif
Other DBs
NCBI-ProteinID: ACU98830
UniProt: C7MRX4
Position
4208707..4210128
Genome map
AA seq 473 aa AA seqDB search
MPEYKQFLLADTAEGLTEAEIVEWKVQPGDEVKVNQIVVEIETAKAAVELPIPWAGVVTE
LLAEPGQTVEVGSPILTVDVDPNGTASPTPSGNGAEPASADSGGDTSGGKGEEEMQPLVG
YGSKGSAPAKRRPRKKAAAVRTGAPEPVQTVEVVRPRTAVEDMTKPAVPPSPASASTFVP
LAKPPVRKLAKELGVDLRTVPGAAQGEVITREDVLRAAEGTSTPPAATGAARAAQPAVDP
ATRERRVPIRGVRKATAQAMVASAYTAPHVTEFLTVDVTPMMELREKLKNSPEFAGIKLT
PLAFAAKAVCLAAKRTPDVNAVWDEDAGEIVYKDYVHLGIAAATPRGLVVPKVRDADSLS
LAELARAIADLTATAREGRTPPEDMLNGTFTITNVGVFGVDGGTPIINPGESAILALGAV
RDMPWVVDGELAVRKVMQLSLSFDHRVVDGQQGSQFLADVGALLSDPAVAITY
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagtacaagcagtttctcctcgccgacaccgcggaggggctgaccgaggccgag
atcgtcgaatggaaggtccagcccggcgatgaggtgaaggtcaaccagatcgtcgtggag
atcgagaccgcgaaagccgccgtcgagctgccgatcccatgggccggcgtggtgaccgag
ttgttggcggagccgggccagaccgtggaggtgggttcgcccatcctcaccgtggacgtc
gacccgaacggcacggcgagcccgacaccgtcggggaacggggcggagcccgcgtccgcc
gactccggcggtgacacctccggtggcaagggcgaggaggagatgcaaccgctggtgggg
tacgggtcgaagggttccgcaccggccaagcgcaggcctcgtaagaaggcggccgcggta
cggaccggtgcccccgagccggtgcagacggtggaggtcgtcaggccgcggacggccgtc
gaggacatgaccaagccggcggttcccccctcgcccgcttccgcctcgacgttcgtgccg
ttggcgaagccgccggtacgcaagctcgccaaggagctgggcgtcgatctgcgtacggtg
ccgggcgcggcccagggtgaggtgatcacgcgcgaggacgtgctccgcgccgccgagggc
acctccacgcccccggccgcgaccggggcggccagggcggcacagcccgccgtggacccc
gccactcgggaacgtcgcgtgcccatccggggtgttcgcaaggcgaccgcgcaggccatg
gtggccagcgcgtacaccgcgccgcacgtcacggagttcctcaccgtcgacgtgaccccc
atgatggaactgcgcgagaagctcaagaacagccccgagttcgccggcatcaagttgacg
ccgctggcgttcgcggccaaggcggtgtgtttggccgcgaaacgcaccccggacgtcaac
gcggtgtgggacgaggacgcgggcgagatcgtctacaaggactacgtgcacctgggcatc
gcggcggccacgccacggggcctcgtggtgcccaaggtccgcgacgccgactccctgtcg
ctggcggagctcgcacgcgccatcgccgacctgaccgccacggcccgggagggcaggaca
ccgcctgaggacatgctgaacggcacgttcaccatcaccaacgtcggcgtgttcggcgtc
gacggcggtaccccgatcatcaatcccggggagtcggccattctggcgctgggtgcggtt
cgggacatgccgtgggtggtggacggcgagctcgcggtgcgcaaggtgatgcagctgtcg
ctgagcttcgaccaccgagtggtcgatgggcagcagggttcgcaattcctcgccgacgtg
ggcgcgctgttgtccgacccggctgtggcgatcacgtactga

DBGET integrated database retrieval system