KEGG   Saccharomonospora viridis: Svir_39540Help
Entry
Svir_39540        CDS       T00980                                 

Definition
sugar kinase, ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
svi  Saccharomonospora viridis
Pathway
Pentose phosphate pathway
Class
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:svi00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4277915..4278805)
Genome map
AA seq 296 aa AA seqDB search
MSAQVLVVGSANADLVVTVDRRPTGGETVLGGDTEILPGGKGANTAVAAARLGAEVALLG
AVGDDAHGRLLLDSLRESGVNTDLVRVVSRPTGLAFITVTPDGENSIIVSPGANHALRPE
DTAVVTAAPKVMVLSMEIPLDTVEHAITSAAGTATCTILNLSPVASVSESTLADVDILLV
NEHEAAWLLGMGERGGVLPNPELSKLLDLGPRAAVVTAGSRGAVIVRPTGLAEVPSPAVE
VVDTTGAGDAFAGALATALARDSELPDAVALAARVAALSVTRRGAQPSYPTVAELE
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgcacaggtgctcgtcgtcggatcggccaacgccgatctcgtggtcacggtcgac
cgtcgccccaccgggggagagaccgttctcggaggggacacggagatcctgcccggtggc
aaaggggccaatacggcggtcgcggccgccagactgggtgccgaggtcgcgttgctgggg
gccgtcggcgacgacgcacacggcaggctgctgctcgactcgctgcgcgagtccggggtg
aacaccgacctcgtgcgggtggtgtcccggccgacggggttggcgttcatcacggtcact
ccggacggtgagaactccatcatcgtctcgcccggggccaatcacgcgctacgccccgag
gacacagcggtcgtcactgcggcaccgaaagtgatggtcctgtcgatggagatcccgctc
gacaccgtcgagcacgcgatcacctccgccgccgggacggcgacgtgcacgatcctcaac
ctctcccccgtcgcctccgtgtccgaatccactctcgccgatgtggatatcctgctcgtc
aacgagcacgaggcggcctggctgctggggatgggggaacgcggcggcgtgctcccgaac
cccgagctgtcgaaactgctcgacctcggcccccgtgcggccgtggtgaccgcgggatcc
cgcggagccgtcatcgtccgacccaccgggcttgccgaggtaccctcaccagccgtcgag
gtcgtcgacacgaccggggccggtgacgccttcgcaggagctctggccactgcgctggcc
cgcgattccgaactacccgacgcggtcgccttggccgcccgggtcgcggcactttcggtc
acccgccgaggtgcccagccctcgtatccgactgtcgccgaattagagtga

DBGET integrated database retrieval system