KEGG   Streptomyces violaceusniger: Strvi_0300Help
Entry
Strvi_0300        CDS       T01602                                 

Definition
(GenBank) catalytic domain-containing protein of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
svl  Streptomyces violaceusniger
Pathway
svl00010  Glycolysis / Gluconeogenesis
svl00020  Citrate cycle (TCA cycle)
svl00620  Pyruvate metabolism
svl01100  Metabolic pathways
svl01110  Biosynthesis of secondary metabolites
svl01120  Microbial metabolism in diverse environments
svl01130  Biosynthesis of antibiotics
svl01200  Carbon metabolism
Module
svl_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:svl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Strvi_0300
   00020 Citrate cycle (TCA cycle)
    Strvi_0300
   00620 Pyruvate metabolism
    Strvi_0300
Enzymes [BR:svl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Strvi_0300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-ProteinID: AEM80088
UniProt: G2PB36
Position
55135..56427
Genome map
AA seq 430 aa AA seqDB search
MAVVREFTLPDLGEGLTGAEIVRWLVQVGDVVAVDQPVVEVETAKAMVDVPCPYGGVVTA
RYGEEGAEVPVGAPLITVAVPEGSDDGSAPPVTESAADGGSGNVLVGYGTAGPAARRRRV
QLSPGPLRETVAVAPAGPLPVISPLVRRLAREHDVDLRQLKGSGPEGLILRADVERAVAA
PARGPEPAPAPASAPAPALAPEGERVPLRGVRGAVADKLARSRREIPDATCWVDADATEL
LAARAAMNAAGGPKVSVLALLARICTAALARFPELNATVDMEGREIIRLPGVHLGFAAQT
DRGLVVPVVRDAQTRTIEGLSEEIARLTEAARTGTLAPAQLTGGTFTLNNYGVFGVDGST
PIINHPEAAMLGVGRIAPKPWVHEGELAVRQVVQLSFTFDHRVCDGGTAGGFLRYVADCV
EQPLVLLRRL
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atggctgtcgtacgggagttcaccctgcccgatctgggcgaggggctgaccggcgccgag
atcgtgcgctggctggtccaggtcggtgatgtggtcgcggtcgaccagccggtggtcgag
gtcgagaccgccaaggcgatggtggacgtgccgtgcccctacggcggcgtggtgaccgcc
cgctacggcgaggagggcgcggaggtgccggtcggggcgccgctgatcacggtcgccgtg
ccggagggctcggacgacggctccgctccgccggtcaccgagagcgcggccgacggcggt
tcgggcaatgtgctggtcggctatggcacggccggtcccgccgcgcggcgccgtcgcgtt
cagctctcccccgggccgctgcgcgagacggtggcggtggcccccgccgggcccctgccg
gtgatctcgcccctcgtacggcggctggcccgggagcacgacgtcgatctgcgccagctc
aagggctcgggccccgaggggctgattctgcgggcggacgtggagcgagcggtggcggct
cccgcacgcggacccgagcccgcacccgcgcctgcctcagcccccgcccccgcgctcgcc
ccggagggggagcgggtgccgctgcgcggggtgcggggcgccgtggccgacaagctcgcc
cgcagccggcgggagatccccgacgcgacctgctgggtggatgccgacgcgaccgaactg
ctcgccgcccgcgcggcgatgaacgccgcgggcgggcccaaggtctccgtgctcgccctc
ctggcccgtatctgcacggcggccctggcgcgcttccccgagctcaacgccacggtggac
atggaaggccgggagatcatccggctccccggcgtccacctcggcttcgcggcgcagacc
gaccggggcctcgtggtccccgtggtgcgcgacgcgcagacgcggaccatagaagggctg
tccgaggagatcgcccggctgaccgaggccgcgcggaccgggacactcgcccccgcgcag
ctcaccggcggcaccttcaccctgaacaactacggggtcttcggggtcgacggctccacg
ccgatcatcaaccaccccgaggcggcgatgctcggggtcgggcggatcgccccgaagccc
tgggtgcacgagggcgagctggcggtgcgccaagtggtgcagctctcgttcaccttcgac
caccgggtatgcgacgggggcaccgccggcggattcctgcggtacgtggccgactgcgtg
gagcagcccctggtgttgttgcgacggctgtag

DBGET integrated database retrieval system