KEGG   Streptomyces violaceusniger: Strvi_0707Help
Entry
Strvi_0707        CDS       T01602                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
svl  Streptomyces violaceusniger
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:svl00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
511161..512165
Genome map
AA seq 334 aa AA seqDB search
MSTTYGSFPGARPRRLRVNPAMRRMVAETRLHPAELILPAFVREDVTEPVPLQTMPGVLQ
HTRDSLRKAAADAVAAGLGGIMLFGVPEESKKDAVGTPGTDPDGILQVAIRDVRAEVGDD
LVIMSDLCLDEHTDHGHCGVLDAEGRIDNDATLERYAEMARAQADAGVHTVGPSGMMDGQ
VGVIREALDGAGHQDISILAYTAKYASAFYGPFREAVGSSLKGDRKTYQQDPANAREAMR
ELELDLAEGADMVMVKPALPYLDILRQIADAVDVPVAAYQISGEYAMVEAAAANGWIDRD
RAIMETLTSVRRAGAGMILTYWATEVAQRLNRGE
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
ttgagcaccacgtacggcagcttccccggtgcgcgaccgcgccggctgcgggtgaatccg
gccatgcgccgcatggtcgcggagacccggctgcatccggccgagctgatcctgcccgcg
ttcgtccgcgaggacgtgaccgagccggtgccgctgcagacgatgccgggcgttctgcag
cacacccgggactccctgcggaaggcggcggccgacgcggtcgccgcgggcctcggcggg
atcatgctcttcggggtgccggaggagtccaagaaggacgccgtcggcacgcccggcacc
gacccggacgggatcctccaggtggccatccgcgatgtgcgcgccgaggtcggcgacgac
ctggtgatcatgtccgatctctgcctggacgagcacaccgaccacggccactgcggggtc
ctggacgccgagggccggatcgacaacgacgccacgctggagcggtacgcggagatggcc
cgcgcccaggccgacgcgggcgtccacacagtgggccccagcggcatgatggacgggcag
gtcggggtgatccgcgaggcgctggacggcgccgggcaccaggacatctcgatcctcgcc
tacaccgcgaagtacgcctccgccttctacggtccgttccgcgaggcggtgggctcctcg
ctgaagggcgaccgcaagacgtatcagcaggacccggccaacgcccgggaggcgatgcgc
gagctggagctggacctggccgagggcgcggacatggtcatggtgaagccggccctgccc
tacctggacatcctgcggcagatcgccgacgccgtggacgtgccggtggccgcctaccag
atctccggtgagtacgcgatggtcgaggcggcggcggccaacggctggatcgaccgcgac
cgcgcgatcatggagacgctgacctcggtacggcgcgcgggcgcggggatgatcctcacg
tactgggcgaccgaggtcgcccagcggctgaaccgcggggagtga

DBGET integrated database retrieval system