KEGG   Streptomyces violaceusniger: Strvi_0841Help
Entry
Strvi_0841        CDS       T01602                                 

Definition
glycoside hydrolase
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
svl  Streptomyces violaceusniger
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:svl00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:svl00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(651499..653010)
Genome map
AA seq 503 aa AA seqDB search
MRSVRSRSPRTTRTALVSALAAVAVAAGPWLTSPADATTADTGSVRAGESVNVYLTTTSG
SDGRTVVKGLEQQAPIRFGSGGGGSVTVDESRMYQEFSGAGASFTDTAAWLFNSSGALSQ
STRDEVMRKLFSPTDGIGVSFLRNPLGGSDLARFGYTFDDVPAGQTDPGLARFSINHDLA
DVLPLTKQARQLNPALKVMASPWTAPAWMKDNDQLNQGWLEAQYYGTYANYFVKYIQEYQ
SRGVPIDYVTVQNEPTCCAGYPSMQWNGSGLNYFTKSELLPKLANAGLKTKVLALDWNWD
QWAGFGAPVVDDAAVRNHPNFGGIAWHGYGGNVGQQTTVHNQYPNVDAFDTEHSGGTWVA
NQQQEDMHNLIDYTRNWGKSWIKWSLAVDQNKGPHNGGCDTCTGLVAVHNGDGQSGRVDY
TVEYYTMGHLTKFVKPGARRIDSSASSTVPNVAWKNPDGSKALIAYNDTGSQQTLKVNWG
SQSFSYQLPARASATFTWTGPQS
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgagatccgtcagatccagatcccctcgtaccacgcgcaccgccctggtgagcgccctg
gccgcggtcgccgtggccgccggcccatggctgacctccccggccgacgccacgaccgcc
gacaccggctcggtcagggccggcgagagcgtcaacgtctatctgaccaccacctccggc
tccgacggccgcaccgtcgtgaagggcctggaacagcaggcgcccatccggttcggctcg
ggcgggggcggcagtgtcaccgtcgacgaatccaggatgtatcaggagttctcgggcgcc
ggggcgtcgttcacggacaccgccgcatggctgttcaacagcagcggcgcactgagccag
agcacccgcgacgaggtgatgcgcaagctcttctcgcccacggacggcatcggggtgagc
ttcctgcgcaacccgctcggcggctccgacctggcccgcttcggttacaccttcgacgat
gtgccggccgggcagaccgaccccggcctcgccaggttctccatcaaccacgacctggcc
gacgtcctgccgctgaccaagcaggccaggcagctcaacccggcgctgaaggtcatggcc
tcgccctggaccgccccggcctggatgaaggacaacgaccagctcaaccagggctggctg
gaggcgcagtactacggcacgtacgcgaactacttcgtgaagtacatccaggagtaccag
agccggggtgtgccgatcgactacgtgaccgtgcagaacgagcccacctgctgcgccggc
tacccgtcgatgcagtggaacggctccgggctcaactacttcacgaagagtgagctgctg
cccaagctggcgaacgcgggcctgaagaccaaggtgctcgccctcgactggaactgggac
cagtgggcgggcttcggtgcgcccgtcgtggacgacgccgccgtccgcaaccacccgaac
ttcggcggcatcgcctggcacggctacggcggcaacgtcggccagcagacgaccgtccac
aaccagtacccgaacgtggacgccttcgacaccgagcactccggcggcacctgggtcgcc
aatcagcagcaggaggacatgcacaacctgatcgactacacccgcaactggggcaagagc
tggatcaagtggagcctcgccgtcgaccagaacaagggcccgcacaacggcggctgcgac
acctgcaccggcctggtcgccgtgcacaacggcgacggccagagcggccgggtggactac
acggtcgagtactacacgatgggccacctcacgaagttcgtgaagcccggagcccgccgc
atcgactccagcgccagctccacggtgccgaacgtggcctggaagaacccggacggctcc
aaggcgctgatcgcctacaacgacaccggcagccagcagaccctgaaggtcaactggggc
agccagtccttcagctaccagctccccgcccgggcctccgccaccttcacctggaccggc
ccccagtcctag

DBGET integrated database retrieval system