KEGG   Streptomyces violaceusniger: Strvi_0841Help
Entry
Strvi_0841        CDS       T01602                                 

Definition
glycoside hydrolase
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
svl  Streptomyces violaceusniger
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:svl00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Strvi_0841
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Strvi_0841
Enzymes [BR:svl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Strvi_0841
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(651499..653010)
Genome map
AA seq 503 aa AA seqDB search
MRSVRSRSPRTTRTALVSALAAVAVAAGPWLTSPADATTADTGSVRAGESVNVYLTTTSG
SDGRTVVKGLEQQAPIRFGSGGGGSVTVDESRMYQEFSGAGASFTDTAAWLFNSSGALSQ
STRDEVMRKLFSPTDGIGVSFLRNPLGGSDLARFGYTFDDVPAGQTDPGLARFSINHDLA
DVLPLTKQARQLNPALKVMASPWTAPAWMKDNDQLNQGWLEAQYYGTYANYFVKYIQEYQ
SRGVPIDYVTVQNEPTCCAGYPSMQWNGSGLNYFTKSELLPKLANAGLKTKVLALDWNWD
QWAGFGAPVVDDAAVRNHPNFGGIAWHGYGGNVGQQTTVHNQYPNVDAFDTEHSGGTWVA
NQQQEDMHNLIDYTRNWGKSWIKWSLAVDQNKGPHNGGCDTCTGLVAVHNGDGQSGRVDY
TVEYYTMGHLTKFVKPGARRIDSSASSTVPNVAWKNPDGSKALIAYNDTGSQQTLKVNWG
SQSFSYQLPARASATFTWTGPQS
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgagatccgtcagatccagatcccctcgtaccacgcgcaccgccctggtgagcgccctg
gccgcggtcgccgtggccgccggcccatggctgacctccccggccgacgccacgaccgcc
gacaccggctcggtcagggccggcgagagcgtcaacgtctatctgaccaccacctccggc
tccgacggccgcaccgtcgtgaagggcctggaacagcaggcgcccatccggttcggctcg
ggcgggggcggcagtgtcaccgtcgacgaatccaggatgtatcaggagttctcgggcgcc
ggggcgtcgttcacggacaccgccgcatggctgttcaacagcagcggcgcactgagccag
agcacccgcgacgaggtgatgcgcaagctcttctcgcccacggacggcatcggggtgagc
ttcctgcgcaacccgctcggcggctccgacctggcccgcttcggttacaccttcgacgat
gtgccggccgggcagaccgaccccggcctcgccaggttctccatcaaccacgacctggcc
gacgtcctgccgctgaccaagcaggccaggcagctcaacccggcgctgaaggtcatggcc
tcgccctggaccgccccggcctggatgaaggacaacgaccagctcaaccagggctggctg
gaggcgcagtactacggcacgtacgcgaactacttcgtgaagtacatccaggagtaccag
agccggggtgtgccgatcgactacgtgaccgtgcagaacgagcccacctgctgcgccggc
tacccgtcgatgcagtggaacggctccgggctcaactacttcacgaagagtgagctgctg
cccaagctggcgaacgcgggcctgaagaccaaggtgctcgccctcgactggaactgggac
cagtgggcgggcttcggtgcgcccgtcgtggacgacgccgccgtccgcaaccacccgaac
ttcggcggcatcgcctggcacggctacggcggcaacgtcggccagcagacgaccgtccac
aaccagtacccgaacgtggacgccttcgacaccgagcactccggcggcacctgggtcgcc
aatcagcagcaggaggacatgcacaacctgatcgactacacccgcaactggggcaagagc
tggatcaagtggagcctcgccgtcgaccagaacaagggcccgcacaacggcggctgcgac
acctgcaccggcctggtcgccgtgcacaacggcgacggccagagcggccgggtggactac
acggtcgagtactacacgatgggccacctcacgaagttcgtgaagcccggagcccgccgc
atcgactccagcgccagctccacggtgccgaacgtggcctggaagaacccggacggctcc
aaggcgctgatcgcctacaacgacaccggcagccagcagaccctgaaggtcaactggggc
agccagtccttcagctaccagctccccgcccgggcctccgccaccttcacctggaccggc
ccccagtcctag

DBGET integrated database retrieval system