KEGG   Streptomyces violaceusniger: Strvi_1101Help
Entry
Strvi_1101        CDS       T01602                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
svl  Streptomyces violaceusniger
Pathway
svl00040  Pentose and glucuronate interconversions
svl00052  Galactose metabolism
svl00500  Starch and sucrose metabolism
svl00520  Amino sugar and nucleotide sugar metabolism
svl01100  Metabolic pathways
svl01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:svl00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Strvi_1101
   00052 Galactose metabolism
    Strvi_1101
   00500 Starch and sucrose metabolism
    Strvi_1101
   00520 Amino sugar and nucleotide sugar metabolism
    Strvi_1101
Enzymes [BR:svl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Strvi_1101
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2
Motif
Other DBs
NCBI-ProteinID: AEM80861
UniProt: G2P0A3
Position
927615..928517
Genome map
AA seq 300 aa AA seqDB search
MTQSRTRISKAVIPAAGLGTRFLPATKATPKEMLPVVDKPAIQYVVEEAVTAGLSDVLMV
TGRNKRPLEDHFDRNYELEEALTRKGDETRLARVQESSDLATMHYVRQGDPRGLGHAVLC
AAPHVGDQPFAVLLGDDLIDARDPLLARMVDVQERHGGSVIALMEVDPAQIHLYGCAAVK
PTVDDDVVQVTGLVEKPDPADAPSNYAVIGRYVLDPAVFGVLRRTEPGRGGEIQLTDALQ
ALASSPDLGGPVHGVVFKGRRYDTGDRSDYLRAIVRLACEREDLGPEFREWLRSYVTEEM
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgactcaatcgcgtactcggatcagcaaggctgtcatccctgccgcggggctcggaacc
cgctttcttccggccaccaaggccacccccaaggagatgctgccggtcgtcgacaagccg
gcgatccagtacgtcgtcgaggaagccgtcaccgccggactgtccgacgtcctcatggtc
accggtcgtaacaagcgacccctggaagaccacttcgaccgcaactacgagctcgaagag
gcactgacccgcaagggcgacgagacccgactcgcccgcgtccaggaatccagcgacctt
gcgaccatgcattacgtccgccagggagaccccaggggtctcggccacgccgtgctctgt
gccgccccgcacgtaggtgaccagccttttgccgtcctcctcggcgacgacctcatcgat
gcccgcgacccgcttctggcccgcatggtcgacgtccaggagcggcacggcggcagcgtc
atcgccctgatggaggtggacccggcacagatccacctctacggctgcgcggcggtcaag
ccgaccgtggacgacgacgtcgtccaggtcaccggcctggtcgagaagcccgaccccgcg
gacgcgcccagcaactacgccgtcatcggccgctatgtgctcgacccggccgtcttcggg
gtgctgcgcaggaccgagccgggccgcggtggcgagatccagctcaccgacgccctgcag
gcgctagcctccagtccggacctcggcggcccggtgcatggcgtcgtcttcaagggacgc
cgctacgacacaggcgaccgtagcgactatctgcgtgccattgtcagactcgcgtgcgaa
cgtgaagacctgggcccggagttccgggaatggcttcgcagttacgtcactgaggagatg
tag

DBGET integrated database retrieval system