KEGG   Streptomyces violaceusniger: Strvi_1101Help
Entry
Strvi_1101        CDS       T01602                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
svl  Streptomyces violaceusniger
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:svl00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Strvi_1101
   00052 Galactose metabolism
    Strvi_1101
   00500 Starch and sucrose metabolism
    Strvi_1101
   00520 Amino sugar and nucleotide sugar metabolism
    Strvi_1101
Enzymes [BR:svl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Strvi_1101
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
927615..928517
Genome map
AA seq 300 aa AA seqDB search
MTQSRTRISKAVIPAAGLGTRFLPATKATPKEMLPVVDKPAIQYVVEEAVTAGLSDVLMV
TGRNKRPLEDHFDRNYELEEALTRKGDETRLARVQESSDLATMHYVRQGDPRGLGHAVLC
AAPHVGDQPFAVLLGDDLIDARDPLLARMVDVQERHGGSVIALMEVDPAQIHLYGCAAVK
PTVDDDVVQVTGLVEKPDPADAPSNYAVIGRYVLDPAVFGVLRRTEPGRGGEIQLTDALQ
ALASSPDLGGPVHGVVFKGRRYDTGDRSDYLRAIVRLACEREDLGPEFREWLRSYVTEEM
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgactcaatcgcgtactcggatcagcaaggctgtcatccctgccgcggggctcggaacc
cgctttcttccggccaccaaggccacccccaaggagatgctgccggtcgtcgacaagccg
gcgatccagtacgtcgtcgaggaagccgtcaccgccggactgtccgacgtcctcatggtc
accggtcgtaacaagcgacccctggaagaccacttcgaccgcaactacgagctcgaagag
gcactgacccgcaagggcgacgagacccgactcgcccgcgtccaggaatccagcgacctt
gcgaccatgcattacgtccgccagggagaccccaggggtctcggccacgccgtgctctgt
gccgccccgcacgtaggtgaccagccttttgccgtcctcctcggcgacgacctcatcgat
gcccgcgacccgcttctggcccgcatggtcgacgtccaggagcggcacggcggcagcgtc
atcgccctgatggaggtggacccggcacagatccacctctacggctgcgcggcggtcaag
ccgaccgtggacgacgacgtcgtccaggtcaccggcctggtcgagaagcccgaccccgcg
gacgcgcccagcaactacgccgtcatcggccgctatgtgctcgacccggccgtcttcggg
gtgctgcgcaggaccgagccgggccgcggtggcgagatccagctcaccgacgccctgcag
gcgctagcctccagtccggacctcggcggcccggtgcatggcgtcgtcttcaagggacgc
cgctacgacacaggcgaccgtagcgactatctgcgtgccattgtcagactcgcgtgcgaa
cgtgaagacctgggcccggagttccgggaatggcttcgcagttacgtcactgaggagatg
tag

DBGET integrated database retrieval system