KEGG   Streptomyces violaceusniger: Strvi_1142Help
Entry
Strvi_1142        CDS       T01602                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
svl  Streptomyces violaceusniger
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:svl00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Strvi_1142
Enzymes [BR:svl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Strvi_1142
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
971189..972115
Genome map
AA seq 308 aa AA seqDB search
MTRPVTARVPAKVNVQLAVGGLRPDGFHDLANVFLAVGLHDEVTATPADTLRITVEGADA
GQVPLDHTNLAARAAVALAERHGIAPGVHLHIAKDIPVAGGMAGGSADAAGALLACDALW
GTKTARDELLHICADLGSDIPFSLVGGAALGRGRGELLTPLETGGTFHWVFAVADGGLST
PAVYRECDRLRETSGAGAGAADVTDPEPSQALLDALRTGDATALAAAVSNDLQPAALSLR
PALAATLRAGADAGALASLVSGSGPTCAFLAKDTEAAQAVAGALAASGTCRTVRITSGPV
PGARLVDA
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
gtgacccgccccgtgaccgcccgtgtgcccgccaaggtcaacgtccagctcgcggtcggc
gggctgcgccccgacgggttccacgatctggccaacgtcttcctcgccgtcgggctccac
gacgaggtcaccgccacccccgccgacaccctccgcatcaccgtcgagggcgcggacgcc
ggccaggtgccgctggatcacaccaacctggccgcccgcgccgccgtcgccctcgccgaa
cggcatggcatcgcgcccggcgtccacctccacatcgccaaggacatccccgtcgcgggc
ggcatggcgggcggcagtgccgacgccgccggggcgctgctggcctgcgacgcgctgtgg
ggcaccaaaaccgcccgcgacgaactcctccacatctgcgccgacttgggcagcgacatc
cccttcagcctcgtcggcggcgccgccctcggccggggccggggcgagctgctgaccccg
ctggagaccggcggcaccttccactgggtgttcgccgtggccgacggcggactgtccacc
cccgccgtctaccgcgaatgcgaccggctgcgcgagacgtccggcgcgggtgcgggcgcc
gccgacgtcacggaccccgagccctcccaggcgctgctggacgcgctgcgcaccggcgac
gccaccgcgctggccgccgccgtatccaatgatctgcagcccgccgcgctgtcgctgcgc
cccgcgctcgccgccaccctgcgcgccggtgcggacgcgggcgcgctcgcctccctcgtc
tccggctcgggcccgacctgcgccttcctggccaaggacaccgaggccgcgcaggcggtg
gcgggcgcgctggccgcctcgggcacctgccgcacggtccggatcacctccggcccggtc
cccggggcacggctcgtggacgcctga

DBGET integrated database retrieval system