KEGG   Streptomyces violaceusniger: Strvi_1312Help
Entry
Strvi_1312        CDS       T01602                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
svl  Streptomyces violaceusniger
Brite
Enzymes [BR:svl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Strvi_1312
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1154557..1155798
Genome map
AA seq 413 aa AA seqDB search
MTEVTADSPSAAELRDKLANELLTQHVIQTKEVEAAFREVPRHLFAPEATLEKAYAQTHV
ATKRDENGITISSVSAPEIQATMLEQAGLRPGHRCLEIGSGGYNAALMASLVGANGEVTT
IDIDPDVTDRARACLKEAGYPQVHVVLTDGEDGCAEHAPYDRTIVTVGSWDIPSAWVDQL
TDGGTITVPLRMRGLTRSITFAREEDHLVSHSAKICGFVTMQGAGAHQERLLLLRGKEIG
LRFDDEWPAEPDSLNGALDTERVEVWSGVKIPRQEQFDTLQMWLATALDGFCLLAVDPKL
DTGLVSPQNKMACPAVVEGGSFAYLALRKLGEEPDPVFEFGAHAFGPDAAALADTMAEQI
LVWSRDHRGGRGPSIAAYPADTPDDRLPEGRVINKRHVRVLISWSTEDLPPAS
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaagtgaccgccgactcgccctcggcagcagagctgcgagacaagctcgcgaat
gagctcttaacccagcacgtgatccagacgaaggaggtcgaagcggcgttccgggaggtg
cccaggcacctgttcgcccctgaggcgaccctggagaaggcgtatgcccagacccatgtg
gctacgaagcgggacgagaacggcatcaccatcagctcggtgtccgctccggaaatccag
gccaccatgctggagcaggcggggctccggcccggtcaccgttgcctggaaatcggctcc
ggtggctacaacgccgcgctgatggcctcgctggtcggcgcgaacggtgaggtcaccacc
atcgacatcgacccggacgttactgaccgggcccgcgcctgcctgaaggaggccggatac
ccgcaagtgcacgtcgtcctcacggatggcgaggacgggtgcgccgagcacgccccttac
gacaggacgatcgtcacggtcggcagttgggacatcccgtcggcctgggtggaccagctc
actgacggcggaaccatcaccgttccccttcggatgcggggcctgacccgatcgatcacc
ttcgcccgagaagaagatcatctggtcagccactcggcgaagatctgcggcttcgtcacg
atgcagggagctggagcgcaccaggaacgactgctactcctgcgcggcaaggagatcggc
ctgcggtttgatgacgagtggccggccgagccggactcgctgaacggtgcgctcgacacc
gagcgagtcgaagtgtggtcgggggtgaagatcccccgccaggagcagttcgacacgctc
cagatgtggctggccaccgcactggacggcttctgtctcctcgcagtcgacccgaagctg
gacacgggcctggtctccccacagaacaagatggcctgcccggccgtggtcgagggaggc
agcttcgcctatctcgccctgcggaagctgggcgaggaaccagatcccgtgttcgagttc
ggagcacacgccttcgggccggacgccgccgcgctcgccgacaccatggccgagcagatc
cttgtctggagccgtgaccaccgcggcgggcgcggcccgagcatcgcggcctacccggcc
gacacccccgatgaccggctccccgaggggcgagtcatcaacaagcggcatgtccgcgtc
ctcatctcctggtcgacggaggacttgcctccggcgagctag

DBGET integrated database retrieval system