KEGG   Streptomyces violaceusniger: Strvi_1459Help
Entry
Strvi_1459        CDS       T01602                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
svl  Streptomyces violaceusniger
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:svl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Strvi_1459
Enzymes [BR:svl01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Strvi_1459
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1318882..1319742)
Genome map
AA seq 286 aa AA seqDB search
MLRLGRREFGENERVIMAIVNRTPDSFYDQGATFRDEPALARVEQAIADGAAIIDIGGVK
AGPGDEVSAEEEAHRTVGFVAEVRRRHPDVVISVDTWRHEVGEAVCAAGADLLNDAWGGV
DPKLAEVAARHGVGLVCTHAGGARPRTRPHRIGYDDVVEDILRVTLELADRALELGVRRD
GIMIDPGHDFGKNTRHSLEATRRLGELTETGWPVLVSLSNKDFVGESLDRPVKERLIGTL
ATTAVSAWLGAQIYRVHEVAETRQVLDMVSSIAGHRPPAVARRGLA
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgctgcggctgggacgacgtgagttcggcgagaacgagcgagtgatcatggcgatcgtg
aaccggacaccggattccttctacgaccagggtgcgaccttccgcgacgagcccgccctg
gcccgcgtggagcaggccatcgcggacggcgccgcgatcatcgacatcggcggcgtcaag
gccggaccgggtgacgaagtgagcgccgaggaggaggcgcaccgcacggtgggcttcgtg
gccgaggtgcgcaggcgccatccggacgtggtgatcagcgtggacacctggcgccatgag
gtcggcgaggcggtctgcgccgcgggcgcggatctgctcaacgacgcctggggcggggtc
gaccccaagctggccgaggtcgccgcccgccacggcgtcgggctggtgtgcacccacgcg
ggcggggcccggccgcgcacccgcccgcaccggatcggctacgacgatgtggtggaggac
atcctgcgggtcaccctggagctcgcggaccgcgccctcgaactgggggtgcggcgcgac
gggatcatgatcgacccgggccatgacttcggtaagaacacccgccactcactggaggcg
acgcgccggctgggcgagctgacggagaccggctggcccgtcctggtctcgctgtccaac
aaggacttcgtcggcgagagcctggaccggccggtcaaggagcggctgatcggcacgctc
gcgacgaccgcggtatcggcctggctgggggcccagatctaccgggtgcacgaggtggcc
gagacccgtcaggtgctggacatggtgtcgtccatcgcgggccaccggcccccggcggtc
gcccgccggggactggcctga

DBGET integrated database retrieval system