KEGG   Streptomyces violaceusniger: Strvi_1662Help
Entry
Strvi_1662        CDS       T01602                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
svl  Streptomyces violaceusniger
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:svl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Strvi_1662
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Strvi_1662
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Strvi_1662
Enzymes [BR:svl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Strvi_1662
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1542499..1543617
Genome map
AA seq 372 aa AA seqDB search
MNAIADAGPRMSGTRQWHGWRGIIEEYRDRLPVSETTPVVTLREGGTPLVPAQVLSERTG
CEVHLKVEGANPTGSFKDRGMTMAISEAKEAGAKAVICASTGNTSASAAAYAVRAGMVCA
VLVPQGKIALGKMGQALVHGAKILQVDGNFDDCLTLARGLSEKYPVALVNSVNPARIQGQ
KTAAFEIVDMLGDAPDVHVLPVGNAGNITAYWKGYKEYAAPFADSEPRASRTPRMWGFQA
SGSAPIVRGEPVKEPSTIATAIRIGNPASWTYAEQARDESGGFIDEVTDRQILAAYRLLA
AQEGVFVEPASAASVAGLLKAAEQGLVDPGQRIVCTVTGNGLKDPDWAVAGAPQPVVVPV
DTDAAAVRLGLA
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcaatcgccgacgccgggcctcgaatgtccggcacccgccagtggcacggctgg
cggggcatcatcgaggagtaccgcgaccgtctcccggtgagcgagacgacgcccgtcgtc
accctgcgcgagggcggtacgccgctggtccccgcgcaggtgctctccgagcgcaccggc
tgcgaggtgcacctcaaggtcgagggcgccaaccccaccgggtcgttcaaggaccgcggg
atgacgatggccatcagcgaggccaaggaggccggcgccaaggccgtcatctgcgcctcc
accggcaacacctcggcctcggcggcggcgtatgccgtacgggccgggatggtctgtgcg
gtgctggtcccgcagggcaagatcgcgctgggcaagatgggtcaggcgctcgtccacggc
gcgaagatcctccaggtcgacggcaacttcgacgactgtctgacgctggcgcgcggactg
tcggagaagtacccggtggcgctggtcaattcggtcaatccggcccggatccaggggcag
aagaccgccgccttcgagatcgtggacatgctcggggacgcgcccgacgtccatgtgctg
ccggtcggcaacgcgggcaacatcaccgcctactggaagggctacaaggagtacgcggcg
ccgttcgccgacagcgagccgcgcgcctcccgtacgccccggatgtgggggttccaggcg
tccggctcggcgccgatcgtgcgcggtgagccggtcaaggagccgagcaccatcgccacc
gccatccgcatcggcaacccggcctcgtggacctacgccgagcaggcacgcgacgagtcc
ggcggcttcatcgacgaggtgaccgaccgtcagatcctcgccgcctaccggctgctcgcc
gcgcaggagggcgtcttcgtggagccggcctccgcggcgagtgtggcgggtctgctgaag
gcggccgagcaggggctggtcgaccccggccagcgcatcgtctgcacggtgaccggaaac
gggctcaaggacccggactgggcggtggcgggcgcgccgcagccggtcgtggtcccggtg
gacacggacgccgcggccgtacggctcgggctggcctga

DBGET integrated database retrieval system