KEGG   Streptomyces violaceusniger: Strvi_1756Help
Entry
Strvi_1756        CDS       T01602                                 

Definition
1,4-alpha-glucan-branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
svl  Streptomyces violaceusniger
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:svl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Strvi_1756
Enzymes [BR:svl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Strvi_1756
Exosome [BR:svl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Strvi_1756
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1642806..1645850)
Genome map
AA seq 1014 aa AA seqDB search
MTARPPSGQHPSDEGPGHPPAATGATTGPAVPGVPSTFLPGHTGPRPQPEQHAAHPAPET
PARHEPEPRGSAERPAPTTSPGPDASETHPAPARKATTHPAPETPAPHKPEPDRSPSRPA
PTTSPRPDASETHPAPHGRPPRQPGPGKRPHRPGPGDATSAAGPREATSAAGQPRPDRRP
GPEEAPDRAPASREDPVSAESAGINPAPDRESLGSAAPEAPLTDSSHPGREARVSYGAEP
VPRAPRADQARRDETDGAAEPSRVAGRPVAGGGGQADVAYNEHGVRPAPALGDEERRRLL
SGAHHAPHDLLGAHPVRGGVLFRCLRPYARSVTVAAAGLRARLRAEGDGLFSGVLPLREI
PDYRLLVTYEDAELELHDPYRFLPTLGELDLHLIGEGRHEELWRALGAHPMTHQGVSGTR
FTVWAPNALGVRLTGDFTYWDGTALPMRSLGGSGVWELFLPGVGEGALYKFEIARPDGGR
SLRADPMARRTECPPATASVVHASHHRWGDEAWLARREGGRVHELPFSVYEVHLPSWRPG
LTYRQLAQQLPAYVKDLGFTHVELMPVAEHPFGGSWGYQVTGFYAPTARLGTPDDFKHLV
DALHQAGIGVLVDWVPAHFPKDAWALAEFDGRPLYEPADPLRAAHPDWGTLEFDYGRTEV
RNFLVANAVYWCEEFHIDGLRVDAVASMLYLDYSREPGQWTPNAQGGRENLDAVAFLQEM
NATVYRRCPGVITIAEESTAWDGVTRATHHVGPSGFGGLGFGLKWNMGWMHDSLAYLAHE
PVHRAYHHHEMTFSMVYAYSENYVLPISHDEVVHGKRALVSKMPGDWWQQRADHRAYLGF
MWAHPGKQLLFMGQEFAQGAEWSEAHGPDWWLLDPSYSAEPDHRGVRDLVRDLNHVYAAT
PALWQRDTDPEGFSWIEGDAREDNVFAFLRFDGDGSPLLAISNFSPVVRQEYRIGTPEAV
PVWREVLNTDDGRYGGSGVANAEPLKAEPTGWHGRPASILPVLPPLATIWLRPA
NT seq 3045 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgcacgaccgccgtccggccagcacccgtccgacgagggaccgggccacccaccc
gcagccaccggcgccacaaccggtccggcggtcccgggagtcccctcgacgttcctcccc
ggccacaccggcccccgtccgcagcccgagcaacacgccgcgcacccggcccccgagacc
ccggcacgccacgaaccggagccgcgcgggagcgcggagcgcccggcgccaaccacctcc
cccggcccggatgcctccgagacgcaccccgcccccgcacggaaggccaccacgcacccg
gcccccgagaccccggcaccccacaagccggagccggaccggagcccgagccgcccggca
ccaaccacctccccccgccccgacgcctccgagacgcaccccgccccgcacgggagaccg
ccccggcagccgggccccgggaaacggccacaccggccgggccccggggacgcgacctcg
gcggccgggccccgggaggcgacctcggccgccgggcagccacgccccgaccggcgcccc
ggccccgaggaggccccggaccgggccccggcctcccgcgaggaccccgtgtccgccgag
tcggcgggcatcaaccccgcgcccgaccgggaatccctcggctcggccgccccggaggcg
ccactcaccgacagcagccaccccggacgcgaggcgcgcgtgtcctacggcgccgagccc
gtgccccgcgcgccgcgggcggaccaggcgcggcgcgacgagaccgacggcgcggccgag
ccgtcgcgtgtcgccgggcggcccgtggccgggggcggcgggcaggccgacgtggcgtac
aatgagcacggtgtgcggcccgcgcccgcgctcggggacgaggagcggcggcggctgctg
tccggggcacatcacgcaccgcatgacctgctcggcgcccaccccgtgcgcggcggtgtg
ctcttccgctgcctgcgcccgtacgctcgctcggtgaccgtcgccgccgccgggctgcgc
gcccggctgcgggccgagggggacgggctgttctccggggtgctgccgctgcgggagatc
ccggactaccggctgctggtgacgtacgaggacgccgagctggagctgcacgacccgtac
cgcttcctgcccaccctcggcgaactcgatctgcacctcatcggtgagggccgccacgag
gagctgtggcgggcgctcggtgcgcatccgatgacccaccagggcgtgtccggcacccgc
ttcaccgtatgggcgcccaatgccctcggggtgcggctgaccggcgacttcacctactgg
gacggcaccgcgctgccgatgcgctcgctcggcggcagcggcgtgtgggagctgttcctg
cccggtgtgggcgagggcgcgctgtacaagttcgagatcgcccggcccgacggcggccgc
tccctgcgcgccgacccgatggcgcggcgcaccgagtgcccgcccgccaccgcctccgtc
gtccatgcctcgcaccaccgctggggggacgaggcgtggctggcgcgccgggagggcggg
cgcgttcatgagctgccgttctccgtctacgaggtgcatctgccgtcctggcggccgggg
ctgacgtaccggcagctcgcgcagcagctcccggcgtacgtcaaggacctcggcttcacc
catgtcgagctgatgccggtggccgagcaccccttcggcggctcctggggctatcaggtc
accggtttctacgcgcccacggcccggctgggcacccccgacgacttcaagcacctggtg
gacgcgctgcaccaggcgggcatcggggtgctggtggactgggtgcccgcgcatttcccg
aaagacgcctgggcgctggcagagttcgacggccgtccgctgtacgagcccgccgatccg
ctgcgggcggcgcatcccgactggggcacgctggagttcgactacgggcgcacggaggtc
cgcaacttcctggtggcgaacgccgtctactggtgcgaggagttccatatcgacggtctg
cgggtggacgccgtcgcctccatgctctacctcgactactcccgcgagcccggccagtgg
acgcccaacgcgcagggcggccgggagaacctggacgcggtcgccttcctgcaggagatg
aacgcgaccgtctaccgccgctgcccgggtgtgatcaccatcgccgaggagtcgaccgcg
tgggacggggtcacccgcgccacccaccatgtgggccccagcggcttcggcgggctcggc
ttcgggctgaagtggaacatggggtggatgcacgactcgctggcgtatctcgcgcatgag
ccggtgcaccgcgcctaccaccaccatgagatgacgttctcgatggtgtacgcgtacagc
gagaactatgtgctgccgatctcgcacgacgaggtggtgcacggcaaacgggccctggtg
tccaagatgcccggcgactggtggcagcagcgcgccgaccaccgcgcgtacctcggcttc
atgtgggcccatccgggcaagcaactgctgttcatggggcaggagttcgcccagggcgcc
gagtggtcggaggcgcatgggcccgactggtggctgctggatccgtcgtactccgcggag
cccgaccaccggggcgtccgcgatctggtccgcgacctgaaccacgtgtacgcggccacg
cccgcgctgtggcagcgggacaccgaccccgagggcttctcctggatcgagggcgacgcc
cgcgaggacaatgtcttcgccttcctccgcttcgacggcgacggctccccgctgctggcc
atcagcaacttctccccggtggtccgccaggagtaccgcatcgggacaccggaggcggtg
cccgtgtggcgcgaggtgctgaacaccgatgacgggcggtacggcggcagcggtgtggcc
aacgccgagccgctgaaggccgagcccacggggtggcacgggcgtccggcctccatcctg
ccggtgctgccgccgctggccacgatctggctgcggcccgcctga

DBGET integrated database retrieval system