KEGG   Streptomyces violaceusniger: Strvi_2021Help
Entry
Strvi_2021        CDS       T01602                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
svl  Streptomyces violaceusniger
Pathway
svl00900  Terpenoid backbone biosynthesis
svl01100  Metabolic pathways
svl01110  Biosynthesis of secondary metabolites
svl01130  Biosynthesis of antibiotics
Module
svl_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:svl00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Strvi_2021
Enzymes [BR:svl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Strvi_2021
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXP_redisom_C DXPR_C
Motif
Other DBs
NCBI-ProteinID: AEM81755
UniProt: G2NTA7
Position
1945925..1947187
Genome map
AA seq 420 aa AA seqDB search
MTESLADPHLRFPAATAAESVRDIVILGSTGSIGTQAIDVVVRNPDRFRVTGLSAAGGRA
GLLAEQAHLLRVDRVAVARPEAVPEVREALSALYGAGEPLPEILAGPDAATELARSQCHT
VLNGITGSIGLAPTLAALEAGRVLALANKESLIVGGSLVKAVAKPGQIVPVDSEHSALFQ
ALLGGAREEVRKLVVTASGGPFRGRTKRELASVTPEQALAHPTWDMGPVVTINSATLVNK
GLEVIEAHLLYDIPFERIEVVVHPQSYIHSMVEFTDGSTLAQASPPDMRMPIALGLGWPE
RVPDAAPGCDWTKAHTWEFFPLDTEAFPSVGLARHVGDLGGTAPAVFNAANEECVDAFLD
GKLPFNGIVDTVAEVVAEHGTPAVGTRLTVADVLEAETWARARATELAARAAKATPEARA
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgacggaatccctggctgacccgcatctgcgctttccggcggccaccgccgcggagagc
gtgcgcgacatcgtgatcctgggctccaccggttcgatcggcacccaggccatcgacgtg
gtggtgcgcaaccccgaccgcttccgcgtgaccggcctgtccgccgccgggggacgggcc
gggctcctcgccgagcaggctcacctgctgcgggtggacagggtggcggtcgcccgtccg
gaggcggtgcccgaggtacgcgaggcgctgagcgcgctctacggagccggtgagccgctc
cccgagatcctggcggggcccgacgcggccaccgagctcgcccgctcccagtgccacacc
gtgctcaacggcatcaccggctccatcggcctggcgccgaccctggccgccctggaggcg
ggccgggtgctggcgctggccaacaaggaatcgctcatcgtcggcggctccctggtcaag
gccgtcgccaagcccggccagatcgtccccgtcgactccgagcactccgcgctcttccag
gcactgctcggcggcgcccgcgaggaggtccgcaagctggtcgtcaccgcctccggcggc
ccgttccgcggccggaccaagcgggagctggcctcggtcaccccggagcaggcgctggcc
caccccacctgggacatgggcccggtggtcacgatcaactccgcgaccctcgtcaacaag
ggcctcgaagtcatcgaggcccatctgctgtacgacattcccttcgagcggattgaggtg
gtggtccaccctcagtcgtatatccactcgatggttgaattcaccgatggctcgacgctc
gcccaggcgagcccgccggatatgcggatgcccatcgcgctcggcctcggctggcccgag
cgggtgccggacgccgcgcccggctgtgactggaccaaggcccacacctgggagttcttt
cccctggacaccgaagcgttcccctctgtcggcctcgcccgccatgtcggcgacctcggc
ggcaccgccccggccgtcttcaacgcggcgaacgaggagtgcgtggacgcgttccttgac
ggaaagctgcctttcaacggaatcgtcgatacggtcgccgaggtggtggccgagcacggc
acccccgccgtgggaacccggctcaccgtcgcggacgtcctcgaggctgagacatgggcc
cgcgcccgcgcaacggaactggccgccagagcggcgaaggcgaccccggaggctcgcgca
tga

DBGET integrated database retrieval system