KEGG   Streptomyces violaceusniger: Strvi_2307Help
Entry
Strvi_2307        CDS       T01602                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
svl  Streptomyces violaceusniger
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:svl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Strvi_2307
Enzymes [BR:svl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Strvi_2307
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2299426..2300925
Genome map
AA seq 499 aa AA seqDB search
MRAANTPGTGRTGHVVVIGGGIAGLAAAHRLLDGGARVTLLEASGRLGGKLRAGEIEGVP
VDLGAESMLARRPEGVELARAVGLGDRLQPPATATASLWTRGGLRPMPKGHVMGVPGDLA
PLAASGVISEDGLARIARDRELPPTPVGEDVALGEYLAARLGREVVDRLVEPLLGGVYAG
DVYRTSMRASVPTLFEVARSGGPLTDGVRELAERAARRQDGPVFMGIDGGIGRLPLAVAD
AVRAAGGEIRTRAAVRELRRTADGWTLAVDGTAGTDGTDGTDGPPVVTADAVVLAVPAPA
AARLLAAAAPAASTELATVDYASMALVTMAFRRDALTGVDALAERSGFLVPPVDGRTIKA
ATFSSRKWGWLRDAGPDLFVLRTSIGRFDDEVDLKRDDADLVRMSLADLGEAVGLTAKPV
ASRVDRWDGGLPQYPVGHLDRVARIRAEIAKVPGLGVCGALYDGVGIPACVGSARKAADE
LLGALAATLEPGSGAGERE
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgagagcggcgaacaccccggggacgggacgcaccggccatgtcgtggtcatcggcggc
ggaatcgcgggcctcgcggcggctcaccggctgctggacggcggggcgcgggtgacgctc
ctggaggcgtcgggacggctcggcggcaagctgcgcgcgggggagatcgagggggtaccg
gtcgacctcggggccgagtcgatgctcgcccgccgcccggaaggcgtcgagctggcgcgc
gccgtgggcctcggcgaccggctgcagccgcccgcgaccgcgaccgcctccctctggacg
cgcggcgggctgcgcccgatgcccaaggggcatgtgatgggcgtccccggtgatctggcg
ccgctggccgcgtccggggtgatctcggaggacgggctggcccggatcgcccgcgaccgg
gagctgccgccgacaccggtcggcgaggacgtggcgctcggcgagtacctcgcggcgcga
ctcggccgcgaggtcgtggaccggctggtcgaaccgttgctgggcggggtgtacgcgggc
gatgtgtaccgcacctcgatgcgcgcctcggtccccaccctcttcgaggtggcccgctcc
ggcggcccgctgaccgacggcgtccgggagctggccgagcgcgccgcgcgacggcaggac
ggcccggtgttcatgggcatcgacggcgggatcggccggctgccgctcgcggtcgccgac
gccgtacgggccgcgggcggcgagatccgcacccgggcggccgtacgggagctgcggcgc
accgccgacggctggaccctcgccgtggacggcacggccggaacggacggcacggacggc
acggacggcccgccggtggtgacggccgacgccgtggtgctggcggtccccgcgcccgcc
gccgcccggctgctggccgccgccgccccggccgcctccaccgagctggccaccgtcgac
tacgcctcgatggcgctggtcaccatggccttccggcgggacgcgctcaccggcgtggac
gcgctcgccgaacggagcggcttcctggtgccgccggtcgacggccggacgatcaaggcg
gcgacgttctccagccgcaaatggggctggctgcgggacgccgggcccgatctcttcgtg
ctgcgtacctcgatcgggcggtttgacgacgaggtggatctgaagcgggacgacgccgac
ctggtaaggatgtcgctcgccgatctcggcgaggccgtcggcctgacggccaagcctgtc
gcgagccgggtggaccgctgggacggcggacttccgcagtacccggtgggccatctcgac
cgggtggcccgcatccgcgccgagatcgccaaggtgccggggctgggggtgtgcggcgcg
ctctacgacggggtgggcatcccggcgtgcgtgggcagcgcccgtaaggcggccgacgag
ctgctgggcgccctggcggccaccctggagccgggctccggagccggagagcgagaatag

DBGET integrated database retrieval system