KEGG   Streptomyces violaceusniger: Strvi_2307Help
Entry
Strvi_2307        CDS       T01602                                 

Definition
(GenBank) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
svl  Streptomyces violaceusniger
Pathway
svl00860  Porphyrin and chlorophyll metabolism
svl01100  Metabolic pathways
svl01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:svl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Strvi_2307
Enzymes [BR:svl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Strvi_2307
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     Strvi_2307
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO Pyr_redox_2 FAD_oxidored FAD_binding_2 HI0933_like HTH_AsnC-type Pyr_redox AlaDh_PNT_C Lycopene_cycl GIDA FAD_binding_3 NAD_binding_7 HTH_24 Thi4 Trp_halogenase
Motif
Other DBs
NCBI-ProteinID: AEM82032
UniProt: G2PCK4
Position
2299426..2300925
Genome map
AA seq 499 aa AA seqDB search
MRAANTPGTGRTGHVVVIGGGIAGLAAAHRLLDGGARVTLLEASGRLGGKLRAGEIEGVP
VDLGAESMLARRPEGVELARAVGLGDRLQPPATATASLWTRGGLRPMPKGHVMGVPGDLA
PLAASGVISEDGLARIARDRELPPTPVGEDVALGEYLAARLGREVVDRLVEPLLGGVYAG
DVYRTSMRASVPTLFEVARSGGPLTDGVRELAERAARRQDGPVFMGIDGGIGRLPLAVAD
AVRAAGGEIRTRAAVRELRRTADGWTLAVDGTAGTDGTDGTDGPPVVTADAVVLAVPAPA
AARLLAAAAPAASTELATVDYASMALVTMAFRRDALTGVDALAERSGFLVPPVDGRTIKA
ATFSSRKWGWLRDAGPDLFVLRTSIGRFDDEVDLKRDDADLVRMSLADLGEAVGLTAKPV
ASRVDRWDGGLPQYPVGHLDRVARIRAEIAKVPGLGVCGALYDGVGIPACVGSARKAADE
LLGALAATLEPGSGAGERE
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgagagcggcgaacaccccggggacgggacgcaccggccatgtcgtggtcatcggcggc
ggaatcgcgggcctcgcggcggctcaccggctgctggacggcggggcgcgggtgacgctc
ctggaggcgtcgggacggctcggcggcaagctgcgcgcgggggagatcgagggggtaccg
gtcgacctcggggccgagtcgatgctcgcccgccgcccggaaggcgtcgagctggcgcgc
gccgtgggcctcggcgaccggctgcagccgcccgcgaccgcgaccgcctccctctggacg
cgcggcgggctgcgcccgatgcccaaggggcatgtgatgggcgtccccggtgatctggcg
ccgctggccgcgtccggggtgatctcggaggacgggctggcccggatcgcccgcgaccgg
gagctgccgccgacaccggtcggcgaggacgtggcgctcggcgagtacctcgcggcgcga
ctcggccgcgaggtcgtggaccggctggtcgaaccgttgctgggcggggtgtacgcgggc
gatgtgtaccgcacctcgatgcgcgcctcggtccccaccctcttcgaggtggcccgctcc
ggcggcccgctgaccgacggcgtccgggagctggccgagcgcgccgcgcgacggcaggac
ggcccggtgttcatgggcatcgacggcgggatcggccggctgccgctcgcggtcgccgac
gccgtacgggccgcgggcggcgagatccgcacccgggcggccgtacgggagctgcggcgc
accgccgacggctggaccctcgccgtggacggcacggccggaacggacggcacggacggc
acggacggcccgccggtggtgacggccgacgccgtggtgctggcggtccccgcgcccgcc
gccgcccggctgctggccgccgccgccccggccgcctccaccgagctggccaccgtcgac
tacgcctcgatggcgctggtcaccatggccttccggcgggacgcgctcaccggcgtggac
gcgctcgccgaacggagcggcttcctggtgccgccggtcgacggccggacgatcaaggcg
gcgacgttctccagccgcaaatggggctggctgcgggacgccgggcccgatctcttcgtg
ctgcgtacctcgatcgggcggtttgacgacgaggtggatctgaagcgggacgacgccgac
ctggtaaggatgtcgctcgccgatctcggcgaggccgtcggcctgacggccaagcctgtc
gcgagccgggtggaccgctgggacggcggacttccgcagtacccggtgggccatctcgac
cgggtggcccgcatccgcgccgagatcgccaaggtgccggggctgggggtgtgcggcgcg
ctctacgacggggtgggcatcccggcgtgcgtgggcagcgcccgtaaggcggccgacgag
ctgctgggcgccctggcggccaccctggagccgggctccggagccggagagcgagaatag

DBGET integrated database retrieval system