KEGG   Streptomyces violaceusniger: Strvi_2397Help
Entry
Strvi_2397        CDS       T01602                                 

Definition
1,4-beta cellobiohydrolase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
svl  Streptomyces violaceusniger
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:svl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Strvi_2397
Enzymes [BR:svl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Strvi_2397
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2404173..2405837
Genome map
AA seq 554 aa AA seqDB search
MRKRRKILTVSTAVVAAATLPLLISPVVSAAAREDDDDSSRIARLYAPPPDRDSYRQVAR
LAWRGDFRDSAGLLAMVRTPQAVWYGDESPERIERLVRRTTRSADVQGKLPVLALYNIPG
RDCGSYSSGGADDLAAYEAWIDAVAEGIGGRKVLIVLEPDSLALLPSDCADESNADQTAV
EEQPVEEQPAEEQLAAEQQTAVEQQPAAEAPSTDLPPLPDPGASTAPPAASDAQGTGQDA
AQSPDAQSPDAQSPDPRLPAYETPAPKPAEAQEPAGLEPSASQSPAPEPSTEQPGTLPEL
PPLPRPDPMTPDLEDVGDLDTPVVEDQETAARYSEINYAVDSLTALGNTSVYLDAGHAGW
HSVSSIVPRLLKAGIDRATGFALNVSHYQTDPDSAWYGRLVSSCLAYADEGGDPEDCADQ
SWSRRHARRWLHAHVPDDPGGMKHFVTDTSRNGQGPWAPRAGAHTDAQSWCNPPARGLGR
RPTTRTGDALLDAALWVKTPGESDGRCLRGTDGPFDPVRGTVNPDAGEWFPEQALELVRY
AEPSVKVFRRSPGR
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtaagagacgcaagattctcaccgtgtcgacggccgtcgtggccgcggccaccctg
cccctgctgatcagccccgtggtgagcgcggccgcgcgggaggacgacgacgattcctcc
cgcatcgcccgcctctacgcccctccccccgaccgggactcctaccgccaggtggcccgg
ctcgcctggcggggcgacttccgcgactccgccggactccttgccatggtgcggacgccg
caggcggtctggtacggcgacgagagcccggagcggatcgagcggctggtccgcaggacg
acgcggagcgccgacgtgcaggggaagctgccggtcctcgccctctacaacatcccgggc
cgtgactgcggcagctactcgagcgggggagcggacgacctcgccgcgtacgaggcgtgg
atcgacgccgtcgccgagggtatcggcggccgtaaggtgctcatcgtcctcgaacccgat
tcgctggcgctgctgccctccgactgcgccgacgaatccaacgccgatcagaccgccgtc
gaggagcagcccgtcgaggagcagcccgccgaggagcaactcgccgccgagcagcagacg
gccgtcgagcaacagcccgccgccgaggcaccgtccaccgatctgcccccgctgcccgac
cccggcgcctcaacggccccgcccgccgcatcggacgcccagggcaccggccaggacgcc
gcgcagtctccggacgcgcagtccccggacgcccagtcccccgacccgcgactccccgcc
tacgagaccccggcgcccaagcccgccgaggcccaggagcccgccggcctcgagccctcc
gcgtcccagagccccgcccccgagccctccaccgagcagcccggcaccctccccgagctg
cccccgctccccaggcccgaccccatgacccccgacctcgaggacgtgggcgacctggac
accccggtggtcgaggaccaggagaccgccgcccgctactccgagatcaactacgcggtc
gacagccttaccgcgctcggcaacacctcggtctacctggacgcgggccacgccggctgg
cactccgtcagcagcatcgtgccccgtctcctcaaggccgggatcgaccgcgccaccggc
ttcgccctcaacgtctcccactaccagaccgaccccgacagcgcctggtacggccggctg
gtctcctcctgcctcgcctacgccgacgagggcggggaccccgaggactgcgccgaccag
agctggtcgcggcggcacgcccgccgctggctgcacgcccatgtgccggacgacccgggc
ggtatgaagcacttcgtcaccgacaccagccgcaacggccagggcccgtgggcccccagg
gccggggcgcacaccgacgcgcagtcgtggtgcaacccgccggcgcggggcctgggcagg
cgccccaccacccgcacgggcgacgcactgctggacgccgcgctgtgggtgaagacgccc
ggcgagtcggacgggcggtgcctgcgcggcaccgacgggccctttgacccggtgcgcggg
accgtcaaccccgacgcgggggagtggttccccgagcaggcgctggagctggtccgctac
gcggaaccgtcggtcaaggtcttccgccggtcccccggccgctga

DBGET integrated database retrieval system