KEGG   Streptomyces violaceusniger: Strvi_2402Help
Entry
Strvi_2402        CDS       T01602                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
svl  Streptomyces violaceusniger
Pathway
svl00010  Glycolysis / Gluconeogenesis
svl00620  Pyruvate metabolism
svl00640  Propanoate metabolism
svl00680  Methane metabolism
svl01100  Metabolic pathways
svl01110  Biosynthesis of secondary metabolites
svl01120  Microbial metabolism in diverse environments
svl01130  Biosynthesis of antibiotics
svl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:svl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Strvi_2402
   00620 Pyruvate metabolism
    Strvi_2402
   00640 Propanoate metabolism
    Strvi_2402
  Energy metabolism
   00680 Methane metabolism
    Strvi_2402
Enzymes [BR:svl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Strvi_2402
Lipid biosynthesis proteins [BR:svl01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Strvi_2402
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AEM82126
UniProt: G2P2K3
Position
2409586..2411316
Genome map
AA seq 576 aa AA seqDB search
MTATNPAHDFREARDFLLDHREDYAAAYEGFGWPRPERFNWALDWFDGIAGRSGDRTALH
IVEEDGSEIRLTFEELRRRSNRAANWLRERGVRAGDRIVVMLGNQVELWETALAAMKLRA
VVIPATPLLGPLDLADRIERGRAAYVVVRGPDTGKFAEVPGDYIRIAVGGAPEGWLAYED
AGTAGITVDPTAGGTGDGAEDDEPFVPDGPTLATDPLMLYFTSGTTARPKLVEHTHISYP
IGHLATMYWIGVRPGDVHLNISSPGWAKHAWSNLFAPWNAEATVFVHNYTRFDATRLMAE
MDRCGITTFCAPPTVWRMLIQADLTQLRTPPREALAAGEPLNPEVIEHVRRAWGVTIRDG
FGQTETAVQVANTPGQPLKPGSMGRPTPGFRVVLLDPVTGRLGEEGEICLDLTGPEGRPV
GLMTGYEGDGERTAEATAGGYYRTGDIGSRDADGYITYIGRADDVFKASDYKISPFELES
ALLEHEAVAEAAVVPAPDALRLAVPKAYIVLAEGWEPGPDTAKALFAHSRAVLAPYKRIR
RLEFADLPKTVSGKIRRIELRERTAQGGGIEFYEEI
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
gtgacagcaacgaatccggctcacgacttccgcgaggcacgggacttcctgctcgaccac
cgggaggactacgcggcggcgtacgaagggttcggctggccacgcccggagcggttcaac
tgggccctggactggttcgacgggatcgccgggcgcagcggcgaccgcaccgccctgcac
atcgtcgaggaggacggcagcgagatccggctgaccttcgaggagctgcgccgccgctcc
aaccgggccgcgaactggctgcgcgagcgcggcgtccgggccggtgaccgcatcgtggtc
atgctcggcaaccaggtcgagctgtgggagaccgcgctggccgcgatgaagctgcgcgcc
gtcgtcatccccgccaccccgctgctcggcccgctcgacctcgctgaccgcatcgagcgc
ggccgggcggcgtatgtggtcgtgcggggcccggacaccggcaagttcgcggaggtgccg
ggcgactacatccggatcgcggtcggcggcgcgcccgagggctggctcgcctacgaggac
gccgggaccgcgggcatcacggtggaccccacggcgggcggtaccggggacggcgcggag
gacgacgagcccttcgtccccgacgggccgaccctggccaccgaccccctgatgctctac
ttcacctccggcaccaccgcccgccccaagctggtcgagcacacccacatctcgtatccc
atcgggcatctggcgacgatgtactggatcggggtcaggccgggtgatgtccacctcaac
atctcctcgcccggatgggccaagcacgcctggtccaatctcttcgccccctggaacgcc
gaggccaccgtcttcgtccacaactacacgcgcttcgacgccacccgcctgatggccgag
atggaccgctgtggcatcaccaccttctgcgccccgcccaccgtctggcggatgctcatc
caggccgatctcacccagctccgcaccccgccccgggaggccctcgccgcgggcgagccc
ctcaaccccgaggtcatcgagcatgtgcggcgcgcctggggggtgaccatccgggacggc
ttcggccagaccgagaccgccgttcaggtggccaacacccccggacagccgctcaagccc
ggctcgatgggacggccgacccccgggttccgggtcgtcctgctggatccggtgaccggc
cggcttggcgaggagggcgagatctgcctcgacctcaccggccccgagggccgtcccgtc
ggcctgatgaccggctacgagggcgacggggagcgcaccgccgaggccaccgcgggcggt
tactaccgcaccggggacatcggatcgcgcgacgcggacggctacatcacctacatcggc
cgcgccgacgacgtcttcaaggcgtccgactacaagatctcgccgttcgagctggagagc
gcgctgctggagcacgaggcggtcgccgaggccgccgtcgtcccggcccccgacgcgctg
cggctggccgtgccgaaggcgtacatcgtgctggcggagggctgggagcccggcccggac
accgcgaaggcgctgttcgcgcactcccgggcggtgctcgcaccgtacaagcggatccgc
cgattggagttcgccgacctccccaagacggtttccggaaagattcgccggatcgagcta
cgtgaacgcacggcacagggtggcggtatcgagttttatgaggagatctga

DBGET integrated database retrieval system