KEGG   Streptomyces violaceusniger: Strvi_2410Help
Entry
Strvi_2410        CDS       T01602                                 

Definition
urate oxidase
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
svl  Streptomyces violaceusniger
Pathway
Purine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Module
Purine degradation, xanthine => urea
Brite
KEGG Orthology (KO) [BR:svl00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Strvi_2410
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    Strvi_2410
Enzymes [BR:svl01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     Strvi_2410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2416391..2417272
Genome map
AA seq 293 aa AA seqDB search
MPTLGPNQYGKAETRVVRVVRDGAVHHLKDLNVSVALSGEMDAVHLSGSNANVLTTDATK
NTVYAFAKEHGIDTAEEFGIRLARHFVTGQETIHRARIRVEEYAWERIQAAGGAAHSFVR
RGQEVRTAQIAYDGERWEVVSGLTGLTVLNTTDSEFWGYVKDRYTTLEETRDRVLATDVH
ARWRYGWSADTQPMPDWDHGHEEARGQLLSAFAETYSLSLQQTLYEMGARVIERRPEVEE
IRLSLPNKHHFLVDLEPFGLTNDNEVYFAADRPYGLIEATVLRDGAEPRIPTD
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgcccacgctcggcccgaaccagtacggcaaagccgaaacccgcgtcgtgcgggtggtg
cgcgacggcgccgtgcaccacctcaaggacctcaatgtctcggtggcgctgtccggagag
atggacgcggtccacctctccggcagcaacgccaacgtcctgacgaccgacgccaccaag
aacaccgtgtacgccttcgccaaggagcacggcatcgacacggccgaggagttcggcatc
cggctggcccgccacttcgtcaccggccaggagaccatccaccgcgcccgcatccgcgtc
gaggagtacgcctgggagcggatccaggcggccgggggcgccgcgcactccttcgtccgc
cgcggccaggaggtccgtaccgcccagatcgcctacgacggcgagcgctgggaggtggtc
tccgggctcaccggcctcaccgtcctgaacaccacggactccgagttctggggctatgtc
aaggaccggtacaccaccctcgaggagacccgcgaccgcgtcctggccaccgatgtgcac
gcccgctggcgctacggctggagcgctgacacccagccgatgccggactgggaccacggc
cacgaggaggcgcgcggccagcttctgagcgcgttcgccgagacctactccctctcgctc
cagcagacgctctacgagatgggcgcgcgggtcatcgagcgccgccccgaggtcgaggag
atacggctctcgctgcccaacaagcaccacttcctggtcgatctggaaccgttcggcctc
accaacgacaacgaggtctacttcgccgccgaccggccgtacgggctcatcgaggccacc
gtgctgcgggacggcgccgagccccggatccccaccgactga

DBGET integrated database retrieval system