KEGG   Streptomyces violaceusniger: Strvi_2413Help
Entry
Strvi_2413        CDS       T01602                                 

Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
svl  Streptomyces violaceusniger
Pathway
svl00620  Pyruvate metabolism
svl00630  Glyoxylate and dicarboxylate metabolism
svl01100  Metabolic pathways
svl01110  Biosynthesis of secondary metabolites
svl01120  Microbial metabolism in diverse environments
svl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:svl00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Strvi_2413
   00630 Glyoxylate and dicarboxylate metabolism
    Strvi_2413
Enzymes [BR:svl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Strvi_2413
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: AEM82137
UniProt: G2P2L4
Position
complement(2420807..2422426)
Genome map
AA seq 539 aa AA seqDB search
MSAPAPSPLAIVDAEPLERQGEVLTDAALTFLAELHHRFTPRRDELLARRAERRAEIART
STLDFLPETAHIRDDPDWRVAPAPPALEDRRVEITGPTDRKMTINALNSGAKVWLADFED
ASAPTWANVIGGQLNLIDAYERRIDFTSPEGKSYALRPDDVLATVVTRPRGWHLDERHLR
AADGRPVPGALVDFGLYFFHNARRLLAQGKGPYFYLPKTESHLEARLWNDVFVFAQDHLS
LPQGTIRATVLIETITAAYEMDEILYELRDHASGLNAGRWDYLFSIVKNFRDGGPGFVLP
DRNAITMTAPFMRAYTELLVRTCHKRGAHAVGGMAAFIPSRRDPEVNTVAFDKVKADKDR
EAGDGFDGSWVAHPDLVPVARASFDAVLGDRPHQKDRLREDVRVTAAELIDVASLDARPT
HDGLRNAVQVGTRYIEAWLRGLGAVAIFNLMEDAATAEISRSQIWQWVNAGVVFENGEKA
TADLVRKVAAEELAAIREEVGEDAFAAGRWSQAHDLLLRVALDADYTEFLTLPAYELLG
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcaccagcgccttccccgctggccatcgtcgacgccgaaccgctggagcgtcag
ggggaggtgctgaccgacgcggccctgaccttcctggccgagctccaccaccgcttcacc
ccgcgccgggacgagctgctcgcgcgccgcgcggagcgccgcgccgagatcgcccgcacc
agcaccctggacttcctcccggagaccgcccacatccgcgacgaccccgactggcgcgtc
gcccccgccccgcccgctctcgaggaccggcgggtggagatcaccgggcccaccgaccgc
aagatgaccatcaacgccctcaactcgggcgccaaggtctggctcgccgacttcgaggac
gcctccgcccccacctgggcgaatgtgatcggcggccagctcaatctgatcgacgcctat
gagcgccggatcgacttcacctcccccgagggcaagagctacgcgctgcggcccgacgat
gtgctggccaccgtcgtcacccggccgcgcggctggcatctcgacgagcgccatctgcgg
gccgccgacggccgccccgtccccggcgctctcgtcgacttcgggctgtacttcttccac
aacgcccgccggctgctcgcccagggcaaggggccgtacttctacctccccaagaccgag
tcgcatctcgaggcccgcctctggaacgacgtcttcgtcttcgcacaggaccatctctcg
cttccgcaagggacgatccgcgccaccgttctgatcgagacgatcacggcggcgtacgag
atggacgagatcctctacgagctccgcgaccacgcctccgggctcaacgcgggccgctgg
gactatctcttctccatcgtcaagaacttccgcgacggcggccccggtttcgtcctgccg
gaccgcaacgcgatcacgatgaccgccccgttcatgcgcgcctacaccgaactgctcgtc
cgcacctgccacaagcgcggcgcgcacgcggtcggcggcatggcggccttcatcccctcg
cgccgcgaccccgaggtcaacacggtcgcgttcgacaaggtcaaggccgacaaggaccgt
gaggcaggcgacggtttcgacggctcctgggtcgcccatccggatctggtcccggtcgcc
cgcgcctccttcgacgcggtcctcggcgaccggccgcaccagaaggaccggctgcgcgag
gacgtccgggtcaccgcggccgaactgatcgacgtcgcgtcgctcgacgccaggcccacg
catgacggcctgcgcaacgccgtgcaggtcggcacccgctatatcgaggcttggctgcgc
ggcctcggcgccgtcgcgatcttcaacctgatggaggacgcggccaccgccgagatctcc
cgctcccagatctggcagtgggtcaacgcgggggtggtcttcgagaacggcgagaaggcc
accgccgatcttgtccgtaaggtcgccgccgaggagctggcggcgatccgcgaggaggtc
ggcgaggacgccttcgccgcgggcaggtggagccaggcgcacgatctgctgctgagggtc
gcgctggacgcggactacacggagttcctgacgctgcccgcgtacgaactgctgggctga

DBGET integrated database retrieval system