KEGG   Streptomyces violaceusniger: Strvi_2445Help
Entry
Strvi_2445        CDS       T01602                                 

Definition
ROK family glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
svl  Streptomyces violaceusniger
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:svl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Strvi_2445
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Strvi_2445
   00052 Galactose metabolism
    Strvi_2445
   00500 Starch and sucrose metabolism
    Strvi_2445
   00520 Amino sugar and nucleotide sugar metabolism
    Strvi_2445
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Strvi_2445
   00524 Butirosin and neomycin biosynthesis
    Strvi_2445
Enzymes [BR:svl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Strvi_2445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2448915..2450069
Genome map
AA seq 384 aa AA seqDB search
MSIYRERVHRGSARATVLRTVGTRERRSHLSAPRVPTVGIDIGGTKVMAGVVDADGIILE
KLRTETPDKSKSPKVVEDTITELVLDLSDRHDVHAVGIGAAGWVDADRNRVLFAPHLSWR
NEPLRDRLAERLDVPVMVDNDANAAAWAEWRFGAGRGEDHLVMITLGTGIGGAILEDGQV
KRGKYGVAGEFGHMQVVPAGHRCPCGNRGCWEQYSSGNALVREARELAAAESPVAYGITD
RVGGNIQEITGPLITELARQGDAMCVELLQDIGQWLGVGIANLAAALDPSCFVIGGGVSA
ADDLLIGPARDAFRRTLTGRGYRPEARIVKAQLGPEAGMVGAADLARLVARRFRRANRRR
VERYERAGSSSPLRLAPRGQAGRE
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgagcatctaccgcgaacgagtgcaccggggctcggcccgggccaccgtattgcggacc
gtcggcacccgtgagcgccgctcgcatctcagcgcgccccgggtgcccacggtcggcatc
gacatcggcggcaccaaggtgatggcaggggtggtcgacgccgacggcatcatcctcgag
aagctgcgcaccgagaccccggacaagtccaagagccccaaggtcgtcgaggacaccatc
accgaactggtgctggacctctccgaccggcacgatgtgcacgccgtgggcatcggcgcc
gcgggctgggtggacgccgaccgcaaccgggtgctcttcgccccgcatctgtcctggcgc
aacgaaccgctgcgcgaccggctcgcggagcggctcgacgtcccggtcatggtcgacaac
gacgccaacgcggccgcgtgggcggagtggcggttcggcgccggacgcggcgaggaccat
ctcgtcatgatcaccctcggcaccggaatcggcggcgcgatcctggaggacggccaggtc
aagcgcggcaagtacggcgtcgcgggggagttcggccatatgcaggtcgtcccggccggc
caccgctgcccctgtggcaaccgcggctgctgggagcagtacagctccggcaacgccctc
gtccgcgaggcccgcgaactggccgccgccgaatcgccggtcgcctacgggatcaccgac
cgggtcggcggcaacatccaggagatcaccgggccgctgatcaccgagctggcccggcag
ggcgacgccatgtgtgtcgaactgctccaggacatcggccagtggctcggcgtcggcatc
gccaatctcgccgccgccctcgacccctcctgcttcgtcatcggcggaggcgtcagcgcc
gccgacgacctgctgatcggccccgcccgggacgccttccggcgcaccctcaccggccgc
gggtaccggccggaagcccggatcgtcaaggcgcagttgggccccgaggccgggatggtc
ggcgccgccgacctcgcccggctggtggcccgccgcttccgccgcgccaaccgccgccgc
gtcgagcggtacgagcgcgccgggtcctcctccccgctgcggctggcgccgcggggtcag
gcaggccgcgaatga

DBGET integrated database retrieval system