KEGG   Streptomyces violaceusniger: Strvi_2445Help
Entry
Strvi_2445        CDS       T01602                                 

Definition
(GenBank) glucokinase, ROK family
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
svl  Streptomyces violaceusniger
Pathway
svl00010  Glycolysis / Gluconeogenesis
svl00052  Galactose metabolism
svl00500  Starch and sucrose metabolism
svl00520  Amino sugar and nucleotide sugar metabolism
svl00521  Streptomycin biosynthesis
svl01100  Metabolic pathways
svl01110  Biosynthesis of secondary metabolites
svl01120  Microbial metabolism in diverse environments
svl01130  Biosynthesis of antibiotics
svl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:svl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Strvi_2445
   00052 Galactose metabolism
    Strvi_2445
   00500 Starch and sucrose metabolism
    Strvi_2445
   00520 Amino sugar and nucleotide sugar metabolism
    Strvi_2445
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Strvi_2445
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Strvi_2445
Enzymes [BR:svl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Strvi_2445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase FGGY_N BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: AEM82166
UniProt: G2P2P3
Position
2448915..2450069
Genome map
AA seq 384 aa AA seqDB search
MSIYRERVHRGSARATVLRTVGTRERRSHLSAPRVPTVGIDIGGTKVMAGVVDADGIILE
KLRTETPDKSKSPKVVEDTITELVLDLSDRHDVHAVGIGAAGWVDADRNRVLFAPHLSWR
NEPLRDRLAERLDVPVMVDNDANAAAWAEWRFGAGRGEDHLVMITLGTGIGGAILEDGQV
KRGKYGVAGEFGHMQVVPAGHRCPCGNRGCWEQYSSGNALVREARELAAAESPVAYGITD
RVGGNIQEITGPLITELARQGDAMCVELLQDIGQWLGVGIANLAAALDPSCFVIGGGVSA
ADDLLIGPARDAFRRTLTGRGYRPEARIVKAQLGPEAGMVGAADLARLVARRFRRANRRR
VERYERAGSSSPLRLAPRGQAGRE
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgagcatctaccgcgaacgagtgcaccggggctcggcccgggccaccgtattgcggacc
gtcggcacccgtgagcgccgctcgcatctcagcgcgccccgggtgcccacggtcggcatc
gacatcggcggcaccaaggtgatggcaggggtggtcgacgccgacggcatcatcctcgag
aagctgcgcaccgagaccccggacaagtccaagagccccaaggtcgtcgaggacaccatc
accgaactggtgctggacctctccgaccggcacgatgtgcacgccgtgggcatcggcgcc
gcgggctgggtggacgccgaccgcaaccgggtgctcttcgccccgcatctgtcctggcgc
aacgaaccgctgcgcgaccggctcgcggagcggctcgacgtcccggtcatggtcgacaac
gacgccaacgcggccgcgtgggcggagtggcggttcggcgccggacgcggcgaggaccat
ctcgtcatgatcaccctcggcaccggaatcggcggcgcgatcctggaggacggccaggtc
aagcgcggcaagtacggcgtcgcgggggagttcggccatatgcaggtcgtcccggccggc
caccgctgcccctgtggcaaccgcggctgctgggagcagtacagctccggcaacgccctc
gtccgcgaggcccgcgaactggccgccgccgaatcgccggtcgcctacgggatcaccgac
cgggtcggcggcaacatccaggagatcaccgggccgctgatcaccgagctggcccggcag
ggcgacgccatgtgtgtcgaactgctccaggacatcggccagtggctcggcgtcggcatc
gccaatctcgccgccgccctcgacccctcctgcttcgtcatcggcggaggcgtcagcgcc
gccgacgacctgctgatcggccccgcccgggacgccttccggcgcaccctcaccggccgc
gggtaccggccggaagcccggatcgtcaaggcgcagttgggccccgaggccgggatggtc
ggcgccgccgacctcgcccggctggtggcccgccgcttccgccgcgccaaccgccgccgc
gtcgagcggtacgagcgcgccgggtcctcctccccgctgcggctggcgccgcggggtcag
gcaggccgcgaatga

DBGET integrated database retrieval system