KEGG   Streptomyces violaceusniger: Strvi_2642Help
Entry
Strvi_2642        CDS       T01602                                 

Definition
(RefSeq) succinyl-CoA ligase (ADP-forming) subunit beta
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
svl  Streptomyces violaceusniger
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:svl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Strvi_2642
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Strvi_2642
   00640 Propanoate metabolism
    Strvi_2642
   00660 C5-Branched dibasic acid metabolism
    Strvi_2642
Enzymes [BR:svl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Strvi_2642
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2678544..2679668
Genome map
AA seq 374 aa AA seqDB search
MDLYEHQARELLQENGVLVPRAEVVDTAEAARAAAERLGGRVVIKAQVKTGGRGKAGGVK
LADDPAAAERTARRILGMDIKGHTVHRVMVAEPVEVEREMYLGFTLDRAAGRFLAIASAE
GGMEIEEVAAHRPEAVARIPIDPAEGVTEAKAAEIAAAGGLPPETAGTIRRLWTVLTAYD
ALLVEINPLVVTRDGAIVALDGKVTLDDNASFRQPSWDDSGDRARDPLEARAAAAGLGYV
KLDGQVGVIGNGAGLVMSTLDVVAGCGARPADFLDIGGGASAQVMADGLSLVLDDPEVRS
VLVNVFGGITACDAVADGIVRALDTVPLTKPLVVRLDGNNAARGRAILGQLAHPLVHQAD
TMDGAAARAAELAA
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atggacctgtacgaacaccaggcacgggaactcctccaagaaaacggcgtgttggtgccg
cgagccgaggtcgtggacacggccgaagccgcccgcgccgccgccgagcggctcggcggc
cgcgtcgtcatcaaggcccaggtgaagaccggcggccggggcaaggccggcggggtgaaa
ctcgccgacgacccggcggcggccgagcggaccgcacgccggatcctgggcatggacatc
aagggccacaccgtccaccgggtgatggtcgccgaaccggtcgaggtggaacgggagatg
tacctcggcttcaccctggaccgggccgcgggtcgctttctggccatcgcctccgccgag
ggcggtatggagatcgaggaggtcgcggcgcaccgccccgaggcggtggcccggatcccg
atcgacccggcggagggggtgaccgaggccaaggccgccgagatcgccgccgccggggga
ctgccgccggagacggccgggaccatccgccggctgtggaccgtcctgaccgcgtacgac
gccctcctggtcgagatcaacccgctggtggtgacccgggacggcgcgatcgtggcgctg
gacggaaaggtcaccctggacgacaacgccagcttccggcagccgtcatgggacgactcc
ggcgaccgcgcccgggacccgctggaggcccgcgccgcggccgccgggctcggctacgtc
aaactggacggccaggtgggcgtcatcggcaacggcgcgggcctggtgatgtccaccctg
gacgtcgtcgcgggctgcggcgcccgccccgccgacttcctcgacatcggcggcggcgcc
tcggcacaggtgatggccgacgggctgtccctcgtcctcgacgaccccgaggtgcgctcc
gtcctggtcaacgtcttcggcggcatcaccgcctgcgacgcggtggccgacggcatcgtg
cgcgccctggacaccgtccccctcaccaaaccactggtcgtccggctcgacggcaacaac
gccgcacgtggccgggccatccttggccaattggctcatccactcgtccaccaggccgac
accatggacggcgccgccgcacgcgccgccgaactcgccgcgtag

DBGET integrated database retrieval system