KEGG   Streptomyces violaceusniger: Strvi_2826Help
Entry
Strvi_2826        CDS       T01602                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase NAD-binding protein
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
svl  Streptomyces violaceusniger
Pathway
svl00071  Fatty acid degradation
svl00280  Valine, leucine and isoleucine degradation
svl00281  Geraniol degradation
svl00310  Lysine degradation
svl00362  Benzoate degradation
svl00380  Tryptophan metabolism
svl00410  beta-Alanine metabolism
svl00640  Propanoate metabolism
svl00650  Butanoate metabolism
svl00903  Limonene and pinene degradation
svl00930  Caprolactam degradation
svl01040  Biosynthesis of unsaturated fatty acids
svl01100  Metabolic pathways
svl01110  Biosynthesis of secondary metabolites
svl01120  Microbial metabolism in diverse environments
svl01130  Biosynthesis of antibiotics
svl01200  Carbon metabolism
svl01212  Fatty acid metabolism
Module
svl_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:svl00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Strvi_2826
   00650 Butanoate metabolism
    Strvi_2826
  Lipid metabolism
   00071 Fatty acid degradation
    Strvi_2826
   01040 Biosynthesis of unsaturated fatty acids
    Strvi_2826
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Strvi_2826
   00310 Lysine degradation
    Strvi_2826
   00380 Tryptophan metabolism
    Strvi_2826
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Strvi_2826
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Strvi_2826
   00281 Geraniol degradation
    Strvi_2826
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Strvi_2826
   00930 Caprolactam degradation
    Strvi_2826
Enzymes [BR:svl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Strvi_2826
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Strvi_2826
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Strvi_2826
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 DAO F420_oxidored NAD_Gly3P_dh_N Pyr_redox_2 UDPG_MGDP_dh_N NAD_binding_8 Herpes_capsid
Motif
Other DBs
NCBI-ProteinID: AEM82526
UniProt: G2P4B9
Position
2889841..2892084
Genome map
AA seq 747 aa AA seqDB search
MNHPTTASTIRWEQDDEGVVTLVLDDPDQSANTMNAAFIDSLDAIADRVEAERDAIRGII
VTSAKKTFFAGGDLNDLLQIGPDQAQEVYEKNLRIKRGLRRIETLGKPVVAAINGAALGG
GLEIALSCHHRIALDAPGSRMGFPEVTLGLLPGSGGVARTVRLLGVTDALLKWLLQGARY
SPRRAQEAGLVQEVVATPEEMLAQARAFIDAHPESAQPWEEKDYRIPGGTPAQPKFAVNL
PAFPANLRKQLGGAPYPAQRNILAAAVEGSQVDFETAQTIEARYFTELVVGQTAKNMIQA
FFFDLQAVNSGANRPQGIEPGRVRKVAVLGAGMMGAGIAYACAKAGIEVVLKDVSAEAAA
KGKAYAEGLLAKALTKGRTAEAERDELLARITPTGDLADLEGCDAVIEAVFEDPALKHKV
FQEIESVVAPDALLCSNTSTLPITLLAEGVQRADDFIGLHFFSPVDKMPLVEIIKGERTG
DKALARAFDLVRQINKTPIVVNDSRGFFTSRVIGHFLNEGVAMVGEGVDPASVEQAAAQA
GYPAKVLSLMDELTLTLPRKIREETRRATEEAGGEWRPHPADAVLDRMVEEFGRPGRSGG
AGFYDYDETTGKRIRLWPGLREHFGRGGSGGSGGSGGSGGSGGSGGEGTRVPLEDMMERM
LFCEAIDTVRLLEEGVLTSVADANIGSILGIGFPGWTGGVLQYINGYEGGVAGFVARARE
LEAAYGERFAPTALLLEKAERGERFTD
NT seq 2244 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaccccaccaccgcctcgaccatccgctgggagcaggacgacgagggcgtcgtc
accctggtgctcgacgaccccgaccagtccgccaacaccatgaacgccgcgttcatcgac
tccctcgacgcgatcgccgaccgcgtcgaggccgagcgggacgccatccgcggcatcatc
gtcacctccgccaagaagaccttcttcgccggcggcgacctcaacgacctcctccagatc
gggcccgaccaggcccaggaggtctacgagaagaacctccgcatcaagcgcgggctgcgc
cggatcgagaccctcggcaagcccgtggtcgccgcgatcaacggcgcggcgctcggcggc
gggctggagatcgcgctctcctgccaccaccgcatcgccctcgacgcccccgggtcccgt
atgggcttccccgaggtcaccctgggcctgctcccgggcagcgggggcgtcgcccgaacc
gtacggctgctcggcgtcaccgacgcgctgctcaagtggctgctccagggggcgcggtac
agcccccggcgcgcccaggaggcggggctggtgcaggaggtcgtggccacccctgaggag
atgctggcccaggctcgggcgttcatcgacgcccaccccgagtcggcacagccctgggag
gagaaggactaccggatcccgggcggcaccccggcgcagccgaagttcgccgtcaatctc
cccgccttccccgccaatctgcgcaagcagctcggcggcgcgccctacccggcgcagcgc
aatatcctggccgccgccgtcgaggggtcccaggtggacttcgagaccgcgcagaccatc
gaggcccggtacttcaccgagctggtcgtcggccagaccgccaagaacatgatccaggcg
ttcttcttcgatctgcaggcggtcaactccggggccaaccggccccaggggatcgagccc
ggtcgggtccgtaaggtcgcggtgctgggcgccgggatgatgggcgcgggcatcgcgtac
gcatgcgccaaggcgggcatcgaggtcgtcctcaaggacgtgtccgcggaggccgccgcc
aagggcaaggcgtatgccgagggactgctggccaaggcgctcaccaagggccggaccgcc
gaggccgagcgggacgagctgctggcccggatcaccccgaccggtgatctcgccgacctc
gaggggtgtgacgcggtcatcgaggcggtcttcgaggacccggcgctcaagcacaaggtg
ttccaggagatcgagagcgtcgtcgccccggacgcgctgctgtgctccaacacctccacc
ctccccatcaccctgctcgccgagggggtgcagcgcgccgacgacttcatcggactgcac
ttcttctcgcccgtcgacaagatgccgctggtcgagatcatcaagggcgagcgcaccggc
gacaaggcgctggcccgcgccttcgatctggtgcggcagatcaacaagaccccgatcgtg
gtcaatgactcccgcggcttcttcacctcccgcgtcatcggccacttcctcaacgagggc
gtggcgatggtgggggagggcgtcgatccggcttccgtggaacaggccgcggcccaggcc
ggatatccggccaaggtgctctccctgatggacgagctgaccctgaccctgccgcgcaag
atccgcgaggagacgcgccgggcgaccgaggaggcgggcggcgagtggcggccgcatccg
gccgacgcggtgctcgaccgcatggtggaggagttcgggcgccccggccgcagtggcggc
gcgggcttctacgactacgacgagacgaccggcaagcggatccggctgtggccggggctg
cgggagcactttgggcggggtgggtctggggggtccggtggttcgggtgggtctggtggt
tcgggtgggtccggtggcgagggcactcgcgtcccccttgaggacatgatggagcggatg
ctcttctgtgaggccatcgacacggtgcggctgctggaggagggcgtgctgacctccgtc
gccgacgccaacatcggctccatcctcggcatcggcttccccggctggacgggcggggtg
ctgcagtacatcaacggatacgagggcggcgtggccggtttcgtggcgcgtgcacgggag
ctggaggcggcgtacggggagcggttcgccccgacggcgctgctgctggagaaggccgag
cggggggagcgcttcacggactag

DBGET integrated database retrieval system