KEGG   Streptomyces violaceusniger: Strvi_2830Help
Entry
Strvi_2830        CDS       T01602                                 

Definition
glycoside hydrolase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
svl  Streptomyces violaceusniger
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:svl00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:svl00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:svl00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2895902..2899642
Genome map
AA seq 1246 aa AA seqDB search
MTTAVGLGLTAADTAVGRSSDAGKFPADVHTYLEDPERTGEGQEPPHTRLRPDGPDRAAW
ERSLDGSWRFAMADRPEDAPSGFWKDGYDASAWQRVQVPHTWQTDDLDHPVFRNVQSEVA
PDDPPKVPRDTNPTGAYVRDITVPRNWDGRRQVIRFDGVTSGWFLWINGHYVGYDQGGYV
PAEFDVTDYLRPGATNRIAVQVHRWSAGSYLEDYDQWRYAGIFRSVSLYSTPTTRMEDAY
VTTDLDASYRDATLRTEVDIARTGSDKSGPHHVTGVLYDPKGREVRRLTAEENAGKAELT
GQIANPAKWSDETPNLYALVLTLRDPGGKAIQSVRQSVGFREIEVKDKQLTLNGKRILIR
GVNRAETDPTTGRHATRARMEQDVRLMKRLNVNAIRTSHYPSDPYLYELADREGILIDDE
MEVETHSHENCPDDCLAERPEWQKAFLERHQGMVERDKNHPSVIMWDTGNEAGLGKAHYA
MAKWTRANEPTRPLYHQSNSPDGDAPYADIAGPRYPTPASLEAKAKTFTKPIVMGEYAHA
MGNSLGNFREFWEVMRAYPNAQGGFIWDWAEQNIRRPLITTPDSSGNDIAASLSGKPKVV
DGYGGKGKALYLSGLDDFVEIYRDPKLDLTGTAVTLDARVKPAEPWTGDFTIVSKGDQYV
LRMKDKDTLEFTITSGGKPRTVTAPVPDGWTGAWHRVTGTYDGTALRLYADGKELAETAW
SGRIDYTGFDLGVGRNNDTMEDGWTGRTAKGTIDQVRVYDTALGAEPLAQDQDPRGDALI
ALDFDDFTRKGSYLSYGLYESGVDGLVTADRDPEPETAQLAWVQAPIRITDPGGEGARTG
KVKVTNERAFTGTEDLALRWTVTEGARTVASGTRALDVGPGESATVRLPAPPANPGGYER
HLTVRAVTAHSTDWAKAGHVVSFGQFAVGGDKVPEPAPAPAAGGRAKAVERGDTVRVGGE
DFQYTFGKKEGTLTSMRVAGRELLRSGPELDAWRAPISNERSDWGTAEGKRWRTLGLDRL
RTTVDGVEVTPGDDGTVTVTVRSTAAAPDVTGASFDQTVAYRVDGAGQVRIRHQVEARGD
FRTLSYLPRIGLQLKVPERYGTFRWYGRGPVENFNDRKDGTPMGVWSSSVEDQYVEYLKP
QDHGNHDDVRWASLTDRGGAGLLVSGDLETGAGAYDELDRAAYPHFLKRNDGWNTLHADH
AVTGAGDTPNPVRDQYRVKADSAYDYTLTLRPLSGGAGAHTGTEGK
NT seq 3741 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccgctgtcggcctcggtctcacggccgcggacacggccgtcgggaggtcgtcg
gacgcgggcaagttccccgccgatgtgcatacgtacctcgaggacccggagcggaccggc
gagggccaggaacccccgcacacccggctgcggccggacgggcccgaccgcgcggcctgg
gagcgcagcctggacggatcctggcggttcgcgatggccgaccggccggaggacgccccg
agcggcttctggaaggacggctacgacgcctcggcgtggcagcgcgtccaggtcccgcac
acctggcagaccgacgacctcgaccatccggtgttccgcaacgtccagagcgaggtggcg
ccggacgatccgcccaaggtgccccgtgacaccaatccgaccggggcgtacgtccgggac
atcacggtaccccggaactgggacgggcgccggcaggtgatccgcttcgacggggtcacc
tccggctggttcctgtggatcaacggccactacgtcggctacgaccagggcggctatgtc
cccgccgagttcgatgtgaccgactatctgcgtcccggcgccaccaaccggatcgccgtc
caggtgcaccgctggagcgcgggatcgtatctggaggactacgaccagtggcgctacgcg
ggcatcttccgctccgtatcgctgtactccacgcccacgacccgcatggaggacgcgtac
gtcaccaccgatctcgacgcctcctaccgggacgccacgctgcgcaccgaagtggacatc
gcgcgcaccggaagcgacaagagcggaccccatcacgtcaccggtgtgctctacgacccc
aaggggcgtgaggtacggcggctgacggccgaggagaacgccgggaaggccgagctgacc
gggcagatcgccaacccggccaaatggtccgacgagacgccgaacctctatgcgctggtg
ctcaccctgcgcgatccgggcggcaaggcgatccagtccgtgcgccagagcgtcggattc
cgtgagatcgaggtcaaggacaagcagctcacgctcaacggcaagcgcatcctgatccgc
ggcgtcaaccgcgccgaaaccgacccgaccaccgggcgccatgccacccgcgcccggatg
gaacaggacgtccggctgatgaagcggctgaacgtgaacgcgatccgcacctcccactac
ccctcggacccgtatctctacgaactcgccgaccgcgagggcatcctgatcgacgacgag
atggaggtcgagacccacagccacgagaactgcccggacgactgcctggccgagcgcccc
gaatggcagaaggcgttcctggagcgtcaccagggcatggtggagcgcgacaagaaccac
cccagcgtcatcatgtgggacaccggaaacgaggccgggctgggcaaggcgcactacgcg
atggcgaagtggacccgggcgaacgagcccacccgcccgctctaccaccagtccaacagc
cccgacggcgacgcgccctacgcggacatcgccggaccccgctacccgaccccggcttcc
ctcgaagccaaggccaagaccttcaccaagcccatcgtgatgggcgagtacgcccacgcc
atgggcaacagcctcggcaacttccgcgagttctgggaggtgatgcgcgcctacccgaat
gcccagggcggcttcatctgggactgggccgagcagaacatccggcgtccgctgatcacc
acccccgactcctccggcaacgacatcgccgcctcactctccggcaagcccaaggtggtc
gacgggtacggcgggaagggcaaggcgctgtatctgtccgggctggacgacttcgtcgag
atctaccgcgatccgaagctcgacctcaccggtaccgccgtcaccctcgacgcccgcgtc
aaaccggccgagccctggaccggggacttcaccatcgtcagcaagggcgaccagtacgtc
ctgcggatgaaggacaaggacaccctcgaattcaccatcaccagcggcggcaagccccgt
accgtcaccgcccccgtgcccgacggctggaccggcgcctggcaccgggtcaccggcacc
tacgacggcaccgcgctgcgcctctatgccgacggtaaggagctcgccgagaccgcgtgg
agcggccgtatcgactacaccggcttcgacctcggcgtcggccggaacaacgacaccatg
gaggacggctggaccggccggaccgccaagggcaccatcgaccaggtccgggtctacgac
accgcgctcggcgcggagccgctcgcccaggaccaggacccccggggcgacgccctgatc
gcgctcgacttcgacgacttcacccgtaagggcagctacctctcctacgggctctatgaa
tccggtgtggacggcctggtcaccgccgaccgcgacccggagccggagaccgcccagctc
gcctgggtgcaggccccgatccggatcaccgacccgggcggtgagggcgcccgcaccggc
aaggtgaaggtcaccaatgagcgcgccttcaccggcaccgaggatctcgccctgcgctgg
acggtgaccgagggcgcgcggaccgtcgcgagcggcacccgcgccctggacgtcgggccc
ggcgagagcgccacggtccggctcccggccccgcccgccaaccccgggggctatgagcgc
catctgaccgtgcgggccgtcacggcgcactccaccgactgggccaaggccgggcatgtg
gtgtccttcggccagttcgcggtcggtggcgacaaggtgcccgagcccgctcccgccccg
gccgcaggcgggcgagccaaggccgtcgagcgcggcgacaccgtgcgggtcggcggcgag
gacttccagtacaccttcggcaagaaggagggcacgctcacctcgatgcgcgtggcgggc
cgcgaactgctccgctccggccccgaactggacgcctggcgcgccccgatcagcaatgag
cgctccgactggggcaccgccgagggcaagcgctggcggaccctgggccttgaccggctg
cgcaccaccgtcgacggggtcgaggtgacccccggcgacgacggcacggtcaccgtcacc
gtccgctccacggccgccgcgcccgatgtgaccggcgcgtccttcgaccagaccgtggcc
taccgggtcgacggcgcgggccaggtccggatccggcatcaggtcgaggcgcgcggcgac
ttccgcaccctgtcctatctgcccaggatcggtctccagctcaaggtgcccgagcggtac
ggcaccttccggtggtacgggcgcggaccggtggagaacttcaacgaccgtaaggacggc
acgcccatgggcgtctggtcctcctcggtcgaggaccagtacgtcgagtatctgaagccc
caggaccacggcaaccacgacgatgtgcgctgggcgtccctcaccgaccgcggcggtgcc
ggactgctggtctccggcgatctggagacgggcgccggcgcgtacgacgaactcgaccgc
gccgcctatccgcacttcctcaagcgcaacgacggctggaacaccctgcacgccgaccac
gccgtcaccggcgccggcgacacccccaacccggtgcgcgaccagtaccgggtgaaggcc
gacagcgcctatgactacacgctcaccctgcgcccgctcagcggcggcgcgggggcgcac
actggaacagaagggaagtaa

DBGET integrated database retrieval system