KEGG   Streptomyces violaceusniger: Strvi_3029Help
Entry
Strvi_3029        CDS       T01602                                 

Definition
Holliday junction DNA helicase subunit RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
svl  Streptomyces violaceusniger
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:svl03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3122374..3122994
Genome map
AA seq 206 aa AA seqDB search
MIAFVSGPVAAVAPDTAVIEVGGIGMALQCTPATLAGLRVGQQARLATSLVVREDSLTLY
GFADDDERQVFELLQTASGVGPRLAQAMLAVHSPDVLRLAVSTGDEKALTAVPGIGKKGA
QRLLLELKDRLGEPLGSAVPSARSAAAPGWSDQLHTALVGLGYATREADEAVAAVTPQAE
EAVAAGGKPQVALLLRAALQTLNRTR
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcgttcgtctccggtccggtggcggccgtcgccccggacaccgccgtgatcgag
gtcggcgggatcgggatggcgctccagtgcacccccgccaccctggccgggctgcgcgtc
ggccagcaggcccggctggccacctccctcgtcgtccgtgaggactcgctgaccctctac
ggcttcgccgacgacgacgagcgccaggtcttcgagctgctccagaccgccagcggggtc
ggcccccggctggcccaggccatgctggcggtgcactccccggacgtgctgcggctcgcg
gtgtccaccggggacgagaaggcgctcaccgccgtccccggcatcggtaagaagggggcg
cagcggctgctgctggagctgaaggaccggctcggcgagccactcggctccgccgtcccc
agcgcccgctccgcggcggcccccggctggagcgaccagttgcacaccgcgctggtcggc
ctcggctacgccacccgggaggccgacgaggcggtggccgccgtcaccccgcaggccgag
gaggcggtggccgcgggcggcaagccccaggtggctctgctgctgcgggccgctctgcag
accctgaaccgcacacggtga

DBGET integrated database retrieval system