KEGG   Streptomyces violaceusniger: Strvi_3063Help
Entry
Strvi_3063        CDS       T01602                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
svl  Streptomyces violaceusniger
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:svl00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:svl00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3159046..3160026
Genome map
AA seq 326 aa AA seqDB search
MKRHLISAADLSRDDAVLILDTAEELARLADRPIKKLPTLRGRTVVNLFFEDSTRTRISF
EAAAKRLSADVINFSAKGSSVSKGESLKDTALTLEAMGADAVVIRHHASGAPHRLATSGW
INGAVVNAGDGTHEHPTQALLDAFTMRRHLTPDASGVGQDLAGRRVTIVGDILHSRVARS
NVHLLATLGAEVTLVAPPTLVPFGVESWPCEVSYDLDAVVGKSDAVMMLRVQRERMNAAF
FPTEREYARRYGLDGDRMARMPEHAIVMHPGPMNRGMEITAEVADSDRCTAVEQVANGVS
IRMAVLYLLLGGNESAVATARTEESK
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgccacctcatctcggccgccgacctctcgcgcgacgatgccgtcctgatcctc
gacaccgccgaggagctggcccggctcgccgaccggccgatcaagaaactgccgaccctg
cgcggccgtaccgtcgtcaacctcttcttcgaggactccacccgcacccgcatctccttc
gaggcggccgccaagcggctgtccgccgacgtcatcaacttctccgccaagggctcctcg
gtctccaagggcgagtccctgaaggacaccgcgctcaccctggaggccatgggcgcggac
gccgtggtgatccgccaccacgcctccggcgccccgcaccggctcgccacctccggctgg
atcaacggcgccgtggtgaacgcgggcgacggcacccatgagcaccccacccaggcgctg
ctcgacgccttcaccatgcgccgccatctgaccccggacgcctccggcgtcggacaggac
ctggccgggcgccgggtcacgatcgtcggcgacatcctgcacagccgggtggcccgctcc
aacgtccatctgctggccaccctgggcgccgaggtcacgctggtcgccccgccgacgctg
gtccccttcggcgtggagagctggccctgcgaggtctcctacgacctggacgcggtggtc
ggcaagagcgacgccgtgatgatgctgcgcgtccagcgcgagcggatgaacgccgcgttc
ttccccaccgagcgggagtacgcccgccgctacggcctggacggcgaccgcatggcgcgg
atgccggagcacgccatcgtcatgcaccccggccccatgaaccgcggtatggagatcacc
gcggaggtcgcggactccgaccgctgcaccgccgtcgagcaggtcgccaacggcgtctcg
atccgcatggccgtcctgtatctgctgctcggcgggaacgagtccgccgtcgccaccgcc
cgcaccgaggagagcaagtga

DBGET integrated database retrieval system