KEGG   Streptomyces violaceusniger: Strvi_3071Help
Entry
Strvi_3071        CDS       T01602                                 

Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
svl  Streptomyces violaceusniger
Pathway
svl00230  Purine metabolism
svl01100  Metabolic pathways
Module
svl_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:svl00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Strvi_3071
Enzymes [BR:svl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Strvi_3071
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_16 AAA_18 RsgA_GTPase AAA_33 AAA_29 AAA_22 ABC_tran Rad17 AAA_25 AAA_30 AAA_28 CbiA CPT Zeta_toxin NTPase_1 MMR_HSR1 AAA_24 RNA_helicase AAA_23
Motif
Other DBs
NCBI-ProteinID: AEM82768
UniProt: G2P342
Position
3169277..3169843
Genome map
AA seq 188 aa AA seqDB search
MAAHSARPRLTVLSGPSGVGKSTVVAHMRKEHPEVWLSVSATTRRPRPGERDGVHYFFVD
DGEFDKLIANGELLEWAEFAGNRYGTPREAVMERLGAGEPVLLEIDLQGARQIRESMPEA
QLVFLAPPSWEELVRRLTGRGTEAPEVIERRLEAARTELAAESEFDTTMVNTSVEDVANE
LLALMRVA
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atggcagcacactccgcacgaccgcgactgaccgtgctctccggcccctctggggtcggt
aagagcacggtcgtcgctcatatgcgcaaagaacaccccgaggtctggctctcggtctcc
gccacgacccgccgaccgcgccccggcgagcgggacggcgtccactatttcttcgtggac
gacggggagttcgacaagctcatagccaatggtgagctgctggagtgggccgaattcgcg
ggcaaccgctacggcaccccgcgtgaggcggtcatggagcgcctcggcgcgggcgagccg
gtgctgctggagatcgatctgcagggcgcacggcagatccgcgagtccatgccggaggcg
cagctcgtcttcctcgcgccgccgagctgggaggagctggtccgccggctcaccggccgg
ggcaccgaggcgcccgaggtcatcgagcggcgcctggaggccgctcggaccgagctggct
gccgagtccgagttcgatacgaccatggtcaatacctccgtcgaggacgtggcaaatgag
ctgctagccttgatgcgagtggcttga

DBGET integrated database retrieval system