KEGG   Streptomyces violaceusniger: Strvi_3139Help
Entry
Strvi_3139        CDS       T01602                                 

Definition
fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
svl  Streptomyces violaceusniger
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:svl00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Strvi_3139
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Strvi_3139
Enzymes [BR:svl01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Strvi_3139
Lipid biosynthesis proteins [BR:svl01004]
 Desaturase
  First
   Strvi_3139
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3288479..3289396)
Genome map
AA seq 305 aa AA seqDB search
MNPSEADRAEQAVAERDAKTAAEVKPLFDTPQTAAAGVAMWIFVVGPPICLIAAAPFVWG
WGLLSALDVGMAVVAYLVSGFGLTVGYHRLFTHRSFKARRGLRIALAVAGSLGVEGSPVQ
WVANHRRHHAFADREDDPHSPWRYGTDTRALLKGLVHAHIGWMLKRELSNRARFAPDIAA
DPDLRLVGRLFGLLTAVSLLSPALVGGLVTGTWTGALSGFLWAGVIRMALLHHVTWSVNS
VCHVAGKRPFISRDKATNFWPLALLSFGESWHNSHHADPTGARHGVLPGQLDPSARLIWV
FEKLR
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgaacccgagcgaggctgaccgcgctgaacaggcggtcgccgaacgcgacgccaagacc
gcggccgaggtcaagccgctgttcgacaccccgcagacggccgcggcgggggtggcaatg
tggatcttcgtcgtcggcccgccgatctgcctgatcgccgcggcgccgttcgtgtgggga
tggggcctgttgtccgcgctggacgtcggcatggcggtggtcgcctacctcgtgtccggc
ttcggactcacggtcggttatcaccgcctcttcacgcatcgctcgttcaaggcacggcgg
ggtctgcggatcgccctggccgtcgcgggttcgctgggtgtcgagggttcaccggtccag
tgggtggcgaaccaccgccgtcatcacgccttcgccgaccgagaggacgacccgcactcg
ccctggcgctacgggacggacacccgcgcgctgctcaaggggcttgtccacgctcacatc
gggtggatgctgaagcgcgagctgagcaaccgtgccaggttcgcgcccgacatcgccgcc
gatcccgacctgcggctcgtcggtcggctcttcgggctgctgaccgccgtctcgctcttg
tctccggcactggtcggcgggctcgtcaccggcacctggaccggcgcgctgagcgggttc
ctctgggccggcgtgatccggatggcgctgctgcaccacgtcacatggtcggtgaactcg
gtctgccacgttgcgggcaaacgtccgttcatcagtcgggacaaggccaccaacttctgg
ccgctcgcgctgctgtccttcggcgagagctggcacaactcacatcacgccgaccccacg
ggtgcgcgccacggcgtcctgccgggccagctcgacccgtcggcccgcctcatctgggtg
ttcgagaagctgcgctga

DBGET integrated database retrieval system