KEGG   Streptomyces violaceusniger: Strvi_3231Help
Entry
Strvi_3231        CDS       T01602                                 

Definition
(GenBank) Acetaldehyde dehydrogenase
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
svl  Streptomyces violaceusniger
Pathway
svl00360  Phenylalanine metabolism
svl00362  Benzoate degradation
svl00620  Pyruvate metabolism
svl00621  Dioxin degradation
svl00622  Xylene degradation
svl00650  Butanoate metabolism
svl01100  Metabolic pathways
svl01120  Microbial metabolism in diverse environments
svl01220  Degradation of aromatic compounds
Module
svl_M00545  Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:svl00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Strvi_3231
   00650 Butanoate metabolism
    Strvi_3231
  Amino acid metabolism
   00360 Phenylalanine metabolism
    Strvi_3231
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Strvi_3231
   00622 Xylene degradation
    Strvi_3231
   00621 Dioxin degradation
    Strvi_3231
Enzymes [BR:svl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Strvi_3231
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh GFO_IDH_MocA NAD_binding_3 CoA_binding
Motif
Other DBs
NCBI-ProteinID: AEM82919
UniProt: G2NZ25
Position
3388444..3389409
Genome map
AA seq 321 aa AA seqDB search
MSSETNTRTKVAIIGSGNIGTDLLIKVLRLSGTLEIAAMAGIDPDSDGLARARRLKVATT
HEGVDGLVKLDEFADVDIVFDATSAGAHKRHEEVLRPLGRTLVDLTPAAIGPYVVPPVNG
DAHLGAPNVNMVTCGGQATIPIVAAVGAVTPVHYGEIVASISSRSAGPGTRANIDEFTET
TASAIERVGGAARGKAIIILNPAEPPLIMRDTVHCLVSGCDTEEVTASVEEMVGRVQAYV
PGYRLKQKVQFDQVSAEAPLRSLLPAEAARADAVKVSVFLEVEGAAHYLPAYAGNLDIMT
SAALRTAERLAAHRSGEEAAR
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
gtgagcagcgagacgaacacccgcaccaaggtggcgatcatcgggtccggcaacatcggc
accgacctcctgatcaaggtgctgcggctctccggcaccctggagatcgccgcgatggcc
ggcatcgaccccgactccgacgggctggcccgcgcccgccggctgaaggtggccaccacc
cacgagggcgtggacgggctggtgaagctggacgagttcgcggacgtggacatcgtcttc
gacgcgacctccgccggtgcccacaagcgccacgaggaggtgctgcgccccctcggccgc
accctcgtcgacctcaccccggcggccatcggcccctatgtggtgcccccggtcaacggc
gacgcccacctcggcgcgccgaacgtcaacatggtcacctgcggcggccaggccacgatc
ccgatcgtggccgcggtgggcgcggtcacccccgtccactacggggagatcgtcgcgtcc
atctcctcccgctccgcgggccccggcacccgggcgaacatcgacgagttcaccgagacc
accgcctccgccatcgagcgtgtcggtggcgccgcccgcggcaaggccatcatcatcctc
aacccggccgagccgccgctgatcatgcgggacaccgtgcactgcctggtctccggctgc
gacaccgaggaggtcaccgcctccgtcgaggagatggtcggccgggtccaggcgtatgtg
cccggataccgcctcaagcagaaggtgcagttcgaccaggtgagcgccgaggccccgctg
cgctcgctgctgcccgccgaggccgcgcgcgccgacgcggtgaaggtctcggtcttcctc
gaggtcgagggcgccgcccactacctcccggcctacgccggaaacctcgacatcatgacc
tcggccgcgctgcgcaccgcggagcgcctggccgcccaccgctccggcgaggaggccgca
cgatga

DBGET integrated database retrieval system