KEGG   Streptomyces violaceusniger: Strvi_3326Help
Entry
Strvi_3326        CDS       T01602                                 

Definition
molecular chaperone GroES
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
svl  Streptomyces violaceusniger
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:svl00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Strvi_3326
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Strvi_3326
  Lipid metabolism
   00071 Fatty acid degradation
    Strvi_3326
  Amino acid metabolism
   00350 Tyrosine metabolism
    Strvi_3326
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Strvi_3326
   00626 Naphthalene degradation
    Strvi_3326
Enzymes [BR:svl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Strvi_3326
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3508680..3509720)
Genome map
AA seq 346 aa AA seqDB search
MRALRLTAWGEAPAPTDVERPVPHGAEVLVRVEAAGLCRSDLHVIDGAPGALPYRLPFTL
GHEVAGQVTALGPAADGVRAGDRVVLYGPWGCGSCARCAAGSDNYCDRRNTLAWHGAGLG
RDGGMAEYLLVPSARHLVPIGDLPADQAAPLSDAGLTSYHAVTGLRHALGEGTTAVVIGV
GGLGHLAVQALHATTASRVLAVDVREDALALADRSGADFGTLMRPDTARVLRARSGGVGA
DAVFDFVGAPQTLELATGVLRPGGELAVVGSGGGSLTVSKPGVLPPGFRLSLPFWGTRQE
LAAVVALAHSGALHVETERFPLSAAAEAIDRLRRGQVRGRTVLVPD
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgagggcactgcggctgacggcctggggcgaggctccggcaccaacagatgtcgagcgg
cccgttccccacggcgccgaggtgctggtgcgggtcgaagccgccggcctgtgccgctcc
gatctgcatgtcatcgacggtgctccgggcgcgctcccctaccggctgccgttcaccctc
ggccacgaggtggccgggcaggtcacggccctggggcccgccgccgacggggtgcgcgca
ggtgaccgcgtggtgctctacgggccgtggggctgtggctcctgcgcgcggtgcgccgcg
ggctccgacaactactgcgatcggcggaacaccctcgcctggcacggggccggactgggc
cgggacggcggaatggccgagtatctgctcgtcccctccgcccgccatctggtgccgatc
ggcgacctgccggccgaccaggccgccccgctctccgacgcgggcctgacgtcctaccac
gccgtgaccgggctccggcacgccctcggcgagggcaccaccgccgtcgtcatcggtgtc
ggcgggctcggccatctggccgtccaggccctccacgcgaccaccgcgagccgcgtgctg
gcggtggatgtccgcgaggacgccctggctctcgcggaccgctccggcgcggacttcggc
accctgatgcgaccggacaccgcccgcgtcctgagggcgcgcagcggtggcgtgggagcg
gacgccgtattcgacttcgtcggcgccccacagacgctggaactggcgaccggcgtcctg
cgccccggcggcgaactcgccgtcgtgggaagcggaggcggcagcctgacggtgtccaag
ccgggtgtcctgccacccggcttccggctctcactgcccttctggggaacgcgccaggaa
ctggccgcggtcgtcgcgctggcacattcgggggcgctccacgtcgagacggagcgcttc
ccgctgtccgccgccgcggaggcgatcgaccggcttcgccggggccaggtgcggggccgg
accgtgctcgtaccggactga

DBGET integrated database retrieval system