KEGG   Streptomyces violaceusniger: Strvi_3425Help
Entry
Strvi_3425        CDS       T01602                                 

Definition
molecular chaperone GroES
Organism
svl  Streptomyces violaceusniger
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3605306..3606466
Genome map
AA seq 386 aa AA seqDB search
MKAAVYEGPRTVTVKDVPDAKIEHPCDIIVQITTTNICGSDLHMYEGRTSFEPGRTLGHE
NLGKVVEVGSAVRKVKVGQYVVLPFNIACGFCKQCERGLTNYCLTMQPEPSAAGAAYGFA
DMGPYQGGQAEYLRVPYGDFNALRLGEDAEERQLDYVMLADIFPTGYHATEMAGVKPGDQ
TVIFGAGPVGLMAAYSAVLRGAGRVWSVDFHSDRLRKAEEIGAIPIDIREQDPSDVVKSA
TLGLGADNGCECVGYQAHDPQGREDASMTMNGLIDCVRFTGAIGVVGVFVPEDPGGKDVQ
GELEAQGKVPIDFGKLWFKGQRIGTGQAPVKRYNRMLRDLIAGGKAEPSWVVSHELGLDE
APSGYEHFDRRDEGWTKVVLHPDGSR
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagctgtatacgagggaccgcggacggtgacggtcaaggatgtgccggacgcg
aagatcgagcatccctgcgacatcatcgtgcagatcaccaccaccaacatctgcggctcc
gatctccatatgtacgaagggcgcacctcgttcgaaccgggccgcaccctggggcacgag
aatctggggaaggtcgtcgaggtcggctcggcggtccggaaggtcaaggtcggtcagtac
gtggtactgccgttcaacatcgcctgcggcttctgcaaacagtgcgaacgcgggctgacc
aactactgcctgaccatgcagccggaaccctctgcggccggagccgcgtacggcttcgcg
gacatggggccgtaccagggcggccaggccgagtatctgcgggtgccgtacggcgacttc
aacgcgctgcggctcggtgaggacgccgaggagcgccagctggactatgtgatgctggcc
gacatctttcccaccggctaccacgccaccgagatggccggcgtcaagcccggggaccag
accgtgatcttcggcgcgggcccggtcgggctgatggcggcctattcggcggtgctcagg
ggcgccggccgggtgtggtcggtggacttccacagcgaccggctgcgaaaggccgaggag
atcggggccatcccgatcgacatccgcgagcaggacccgtccgacgtcgtcaagtcggcc
accctggggctcggcgccgacaacggctgtgagtgcgtgggctaccaggcccatgacccg
caaggccgcgaggacgcctccatgaccatgaacggcctgatcgactgtgtgcggttcacc
ggcgcgatcggcgtcgtgggcgtgttcgtccccgaggacccgggcgggaaggacgtccag
ggtgaactcgaggcccagggcaaggtgccgatcgacttcggcaagctgtggttcaagggc
cagcggatcggcaccggccaggcgccggtgaagcggtacaaccggatgctgcgcgatctg
atcgccgggggcaaggccgagccgagctgggtcgtctcccatgagctcgggctggacgag
gccccgagcggctatgagcacttcgaccgccgcgacgagggctggaccaaggtcgtcctg
cacccggacggctcgcgctga

DBGET integrated database retrieval system