KEGG   Streptomyces violaceusniger: Strvi_3425Help
Entry
Strvi_3425        CDS       T01602                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
Organism
svl  Streptomyces violaceusniger
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_N_assoc AlaDh_PNT_C Glu_dehyd_C GCD14 HI0933_like
Motif
Other DBs
NCBI-ProteinID: AEM83098
UniProt: G2NZ55
Position
3605306..3606466
Genome map
AA seq 386 aa AA seqDB search
MKAAVYEGPRTVTVKDVPDAKIEHPCDIIVQITTTNICGSDLHMYEGRTSFEPGRTLGHE
NLGKVVEVGSAVRKVKVGQYVVLPFNIACGFCKQCERGLTNYCLTMQPEPSAAGAAYGFA
DMGPYQGGQAEYLRVPYGDFNALRLGEDAEERQLDYVMLADIFPTGYHATEMAGVKPGDQ
TVIFGAGPVGLMAAYSAVLRGAGRVWSVDFHSDRLRKAEEIGAIPIDIREQDPSDVVKSA
TLGLGADNGCECVGYQAHDPQGREDASMTMNGLIDCVRFTGAIGVVGVFVPEDPGGKDVQ
GELEAQGKVPIDFGKLWFKGQRIGTGQAPVKRYNRMLRDLIAGGKAEPSWVVSHELGLDE
APSGYEHFDRRDEGWTKVVLHPDGSR
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagctgtatacgagggaccgcggacggtgacggtcaaggatgtgccggacgcg
aagatcgagcatccctgcgacatcatcgtgcagatcaccaccaccaacatctgcggctcc
gatctccatatgtacgaagggcgcacctcgttcgaaccgggccgcaccctggggcacgag
aatctggggaaggtcgtcgaggtcggctcggcggtccggaaggtcaaggtcggtcagtac
gtggtactgccgttcaacatcgcctgcggcttctgcaaacagtgcgaacgcgggctgacc
aactactgcctgaccatgcagccggaaccctctgcggccggagccgcgtacggcttcgcg
gacatggggccgtaccagggcggccaggccgagtatctgcgggtgccgtacggcgacttc
aacgcgctgcggctcggtgaggacgccgaggagcgccagctggactatgtgatgctggcc
gacatctttcccaccggctaccacgccaccgagatggccggcgtcaagcccggggaccag
accgtgatcttcggcgcgggcccggtcgggctgatggcggcctattcggcggtgctcagg
ggcgccggccgggtgtggtcggtggacttccacagcgaccggctgcgaaaggccgaggag
atcggggccatcccgatcgacatccgcgagcaggacccgtccgacgtcgtcaagtcggcc
accctggggctcggcgccgacaacggctgtgagtgcgtgggctaccaggcccatgacccg
caaggccgcgaggacgcctccatgaccatgaacggcctgatcgactgtgtgcggttcacc
ggcgcgatcggcgtcgtgggcgtgttcgtccccgaggacccgggcgggaaggacgtccag
ggtgaactcgaggcccagggcaaggtgccgatcgacttcggcaagctgtggttcaagggc
cagcggatcggcaccggccaggcgccggtgaagcggtacaaccggatgctgcgcgatctg
atcgccgggggcaaggccgagccgagctgggtcgtctcccatgagctcgggctggacgag
gccccgagcggctatgagcacttcgaccgccgcgacgagggctggaccaaggtcgtcctg
cacccggacggctcgcgctga

DBGET integrated database retrieval system