KEGG   Streptomyces violaceusniger: Strvi_3557Help
Entry
Strvi_3557        CDS       T01602                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
svl  Streptomyces violaceusniger
Pathway
svl00010  Glycolysis / Gluconeogenesis
svl00030  Pentose phosphate pathway
svl00051  Fructose and mannose metabolism
svl00052  Galactose metabolism
svl00680  Methane metabolism
svl01100  Metabolic pathways
svl01110  Biosynthesis of secondary metabolites
svl01120  Microbial metabolism in diverse environments
svl01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:svl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Strvi_3557
   00030 Pentose phosphate pathway
    Strvi_3557
   00051 Fructose and mannose metabolism
    Strvi_3557
   00052 Galactose metabolism
    Strvi_3557
  Energy metabolism
   00680 Methane metabolism
    Strvi_3557
Enzymes [BR:svl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Strvi_3557
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Strvi_3557
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: AEM83226
UniProt: G2P3J8
Position
complement(3729650..3730675)
Genome map
AA seq 341 aa AA seqDB search
MRIGVLTSGGDCPGLNAVIRSIVHRATVDHGDEVIGFHDGWKGLLEADYRKLDLDAVGGI
LALGGTILGSTRVRPEHLRDGVERAKGHVAELGLDAVIPIGGEGTLKAARLLSDAGLPIV
GVPKTIDNDIASTDVTFGFDTAVGVATEALDRLKTTAESHQRVLIVEVMGRHTGWIALHS
GMAAGAHAIVVPERPFDIEELTKAVGARFEAGKKFAIVVVAEGAKPREGTMDYEAGGKDV
YGHERFAGIARHLSVELERRLGKEARAVILGHVQRGGTPTAYDRVLATRFGWHAVEAAHR
GAFGTITALRGTDIDLVPLATAVERLKTVPAERYAEAECVL
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgcgcattggtgtgctcacgtccggcggcgactgccccggcctgaacgcggtcatcagg
tcaatcgtccaccgcgccaccgtcgaccacggcgatgaggtgatcggcttccacgacggc
tggaagggcctgctggaggccgactaccgcaagctcgacctggacgccgtgggcggcatc
ctggccctcggcggcaccatcctcggctccacccgggtgcgccccgagcatctgcgggac
ggcgtggagcgggccaaggggcatgtggcggagctcggcctggacgcggtcatccccatc
ggtggggagggcacgctgaaggccgcccggctgctctcggacgccggactgccgatcgtc
ggcgtgccgaagaccatcgacaacgacatcgcctcgaccgatgtgaccttcggcttcgac
accgcggtcggcgtcgccaccgaggccctggaccggctcaagaccaccgcggagtcccat
cagcgggtgctgatcgtcgaggtcatggggcggcacaccggctggatcgcgctgcactcg
ggcatggccgcgggcgcccacgccatcgtcgtcccggagcgcccgttcgacatcgaggag
ctcaccaaggccgtcggggcgcggttcgaggcgggcaagaagttcgcgatcgtggtggtg
gcggagggcgccaagccgcgcgagggcacgatggactacgaggccggcggcaaggacgtc
tacggccacgagcgcttcgcgggcatcgcccgccacctctccgtcgagctggagcggcgg
ctcggcaaggaggcgcgggcggtcatcctgggccatgtgcagcgcggtggcaccccgacg
gcgtacgacagggtgctggccacccgcttcggctggcacgccgtcgaggcggcccaccgc
ggcgccttcggcacgatcacggcgctgcgcggcacggacatcgacctggtgccgctcgcg
acggccgtggagcggctgaagacggtccccgccgagcggtacgccgaggccgagtgcgta
ctgtag

DBGET integrated database retrieval system