KEGG   Streptomyces violaceusniger: Strvi_3647Help
Entry
Strvi_3647        CDS       T01602                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
svl  Streptomyces violaceusniger
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:svl00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Strvi_3647
Enzymes [BR:svl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Strvi_3647
Exosome [BR:svl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Strvi_3647
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3824196..3825713
Genome map
AA seq 505 aa AA seqDB search
MPEFVGAVDQGTTSTRFMIFNHDGDEVARYQLEHRQILPRAGWVEHDPVEIYERTNSVMQ
NALREGGLTADDLAAMGITNQRETTVIWDPRNGRPYYNAIVWQDTRTDTIAAALERDGRG
EIIRRKAGLPPATYFSGGKIKWILENVEGVREAAERGHALFGNTDAWVLWNLTGGPGAGV
HATDVTNASRTMLMNLETLDWDDELLEIFGIPRAMLPTINPSSHPEAFGQARTSRPLRTA
TPITGVLGDQQAATVGQVCFAPGEAKNTYGTGNFLLLNTGAELIRSTSGLLTTVAYQFGD
SPPVYALEGSIAVTGSAVQWLRDQMKMIDEASGSERLARTVEDNGGVYFVPAFSGLFAPY
WRSDARGAIVGLTRYNTNGHIARATLEAICYQSRDVVEAMERDADIHLDVLRVDGGVTDN
ELCMQIQADVLGVPVSRPVIAETTALGAAYAAGLATGFWRDTDELRSHWSESRRWEPQWD
QKAREEGYAGWKKAVQRTLDWITVE
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgccggaattcgtcggtgcggtggaccagggaaccaccagcacccgcttcatgatcttc
aaccacgacggcgacgaggtggctcggtaccagctcgagcaccgccagatcctgccgcgc
gcggggtgggtcgagcacgatccggtggagatctacgagcgcaccaactccgtgatgcag
aacgccctccgcgagggcggcctcacggccgacgacctggccgcgatgggcatcaccaat
cagcgcgagaccacggtgatctgggatccgcgcaacggccgcccgtactacaacgccatc
gtctggcaggacacccgcaccgacaccatcgccgccgccctcgaacgggacggccgtggc
gagatcatccgccgcaaggcggggctgccgcccgccacctacttctccggcggcaagatc
aaatggattctggagaacgtcgagggcgtccgcgaggccgccgagcgcggccacgccctc
ttcggcaacaccgacgcctgggtgctgtggaacctcaccggcggccccggcgccggcgtc
cacgccaccgatgtcaccaacgccagccgcaccatgctgatgaacctggagacgctggac
tgggacgacgaactgctggagatcttcggcattccgcgcgcgatgctgccgacaatcaac
ccctcctcccaccccgaggcgttcggccaggcccgcacctcccgcccgctgcgcaccgcc
acccccatcaccggcgtcctcggcgaccagcaggcggccacggtcggccaggtctgcttc
gctcccggtgaggccaagaacacctatggcaccggtaacttcctgctgctcaacaccgga
gcggagctgatccgctcgaccagcgggctgctcacgaccgtggcgtaccagttcggcgac
agccctcccgtctacgccctggagggctcgatcgccgtcaccggctcggccgtccagtgg
ctgcgcgaccagatgaagatgatcgacgaggcctccgggagcgagcggctcgcccgcacc
gtcgaggacaacggcggggtgtacttcgtgcccgccttctccgggctcttcgccccgtac
tggcgctccgacgcccggggcgcgatcgtcggcctcacccgctacaacaccaatggccat
atcgcccgggccaccctggaggccatctgctaccagagccgggacgtggtcgaggccatg
gagcgggacgccgacatccacctggacgtcctgcgggtggacggcggggtcaccgacaac
gagctgtgcatgcagatccaggccgatgtgctgggcgtaccggtcagccgcccggtcatc
gccgagaccaccgccctgggcgccgcctacgccgcggggctggccacgggtttctggcgg
gacaccgatgagctgcgctcccactggagcgagtccaggcggtgggagccccagtgggac
cagaaggccagggaggagggctacgcgggctggaagaaggccgtccagcgcactctggac
tggatcacggtcgagtag

DBGET integrated database retrieval system