KEGG   Streptomyces violaceusniger: Strvi_3713Help
Entry
Strvi_3713        CDS       T01602                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
svl  Streptomyces violaceusniger
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:svl00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Strvi_3713
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Strvi_3713
Enzymes [BR:svl01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Strvi_3713
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3900744..3901232
Genome map
AA seq 162 aa AA seqDB search
MSLYDIPLHTLTGEPTSLGEHRGAALLVVNVASKCGLTPQYEGLERLQQRYAERGFTVLG
VPCNQFAGQEPGTSEEIQTFCSTTYGVSFPLLEKIDVNGEQRHPLYAELTRTPDAQGEAG
DVQWNFEKFLISPEGDVVGRFRPRTEPEADDVVAAIEARLPR
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgtacgacattcccctgcacacccttaccggcgagccgacctctctcggtgag
catcggggcgcggcgctgctggtggtcaatgtggcgtccaagtgcggtctcaccccgcag
tacgaggggctcgagcggctgcagcagcgttatgccgagcgcgggttcaccgtgctgggg
gttccgtgcaatcagttcgccgggcaggagccggggacgagcgaggagatccagacgttc
tgctcgacgacctacggcgtgtccttcccgctgctggagaagatcgatgtcaacggcgag
cagcggcatccgctctacgccgagctgacgcggacgccggacgcgcagggcgaggcgggg
gatgtgcagtggaacttcgagaagttcctgatctcgccggagggtgacgtcgtgggccgg
ttccggccgcgcaccgagccggaggcggacgacgtcgtcgccgcgatcgaggcgcggctt
ccccggtga

DBGET integrated database retrieval system