KEGG   Streptomyces violaceusniger: Strvi_3740Help
Entry
Strvi_3740        CDS       T01602                                 

Definition
glycoside hydrolase clan GH-D
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
svl  Streptomyces violaceusniger
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:svl00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:svl00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:svl00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3931895..3933124)
Genome map
AA seq 409 aa AA seqDB search
MQRSTRSRGLRSCLATVTAATTVAAGALTVSLTTAAPQAVALDNGLARTPPMGFNNWNAT
HCDASFNESMVKGVADAFVSLGLKDVGYTYVNIDDCWAEPSRDASGNLVPHHTRFPNGIK
AVADYVHAKGLKFGIYTSAGTKTCNAANGFPGALDHEKQDAKQFASWGVDYLKYDNCNNQ
GVDAQKRYKAMRDALAATGRPILYSLCEWGQTTPKVWTWGEPVGNSWRTTGDISDKWSSM
IDKLHINDDLAQYAGPGHWNDPDMLEVGNGGMTATEYRTHFSLWAMMAAPLLIGSDIRNA
SATAQSILKNTDIIALDQDTLGKQATIVSSSGGKTVYTKQLANGDHAVALLNENSSSKTI
STTASAIGLGGSSSYRLKDLWSKATSTTSGSISASVPAHGTVVYRVSRG
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagatccacacgatcacgcggtcttcgctcctgcctcgcgaccgtcaccgcggcc
accacggtcgccgccggcgccctcaccgtgagcctcaccaccgcggcgccgcaggccgtc
gcgctggacaacggcctcgcccgtacgcccccgatgggcttcaacaactggaacgccacc
cactgcgacgcctcgttcaacgagtccatggtcaaaggcgttgccgacgcgttcgtctca
ctcggcctcaaggacgtgggctacacctacgtcaacatcgacgactgctgggccgagccc
agccgggacgcgagcggcaatctggtgccccaccacacccgcttcccgaacggcatcaag
gccgtggcggactatgtgcacgccaaggggctgaagttcgggatctacaccagcgccggc
accaagacctgcaacgcggcgaacggcttcccgggcgcgctggaccacgagaagcaggac
gccaagcagttcgcctcctggggcgtggactacctcaagtacgacaactgcaacaaccag
ggcgtcgacgcccagaagcgctacaaggccatgcgcgacgcgctcgccgccaccggccgc
ccgatcctctactcgctgtgcgaatggggccagaccacccccaaggtgtggacctggggc
gagccggtcggcaactcctggcgcaccaccggcgacatcagcgacaagtggtccagcatg
atcgacaagctgcacatcaacgacgatctggcgcagtacgcgggccccggccactggaac
gaccccgacatgctggaggtcggcaacggcgggatgacggccaccgagtaccgcacccac
ttcagcctgtgggcgatgatggcggcgccgctgctgatcggcagcgacatccggaacgcc
tccgcgaccgcccagtcgatcctgaagaacaccgacatcatcgcgctcgaccaggacact
ctgggcaagcaggccaccatcgtctcctccagtggcgggaagaccgtgtacaccaagcaa
ctggccaacggcgaccacgcggtggcgctgctcaacgagaactcgtccagcaagacgatc
tcgacgacggcgagcgcgatcggcctcggcggctcgtcctcgtaccgcctgaaggatctg
tggtcgaaggccacctccaccacgagcggctcgatcagcgcctcggtgcccgcgcacggc
acggtcgtctaccgggtctcccgcggctga

DBGET integrated database retrieval system