KEGG   Streptomyces violaceusniger: Strvi_3802Help
Entry
Strvi_3802        CDS       T01602                                 

Definition
dTDP-4-dehydrorhamnose 35-epimerase-like protein
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
svl  Streptomyces violaceusniger
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:svl00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Strvi_3802
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Strvi_3802
Enzymes [BR:svl01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Strvi_3802
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4039898..4040494
Genome map
AA seq 198 aa AA seqDB search
MKVRELAVSGAYEFSPDVHRDERGAFVAHYTEAAFAAAVGHPLRLGQNHHSVSRRGTVRG
VHYADVPPGQAKMVTCTSGELLDVVVDLRMGSPTFGHWDSVRLDPVSYRAVYLEEGLGHA
FIALRDDTVAAYLNSAEYNPGAEHEIDPFDPALGLPWPTDLEYLVSQRDRNAPGLAEAER
AGLLPSYEVCRALHPRRD
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtgcgtgagctggcggtctccggcgcctacgagttcagcccggacgtccaccgc
gacgagcgcggcgcgttcgtcgcccactacaccgaagcggccttcgccgcggccgtcggg
catccgctgcgcctgggccagaaccaccacagcgtctcccggcgcggcaccgtccgcggg
gtgcactacgcggacgtacccccgggccaggccaagatggtgacctgcaccagcggcgaa
ctcctcgacgtggtcgtggacttgaggatgggctcgcccaccttcggccactgggacagc
gtgcgcctggaccccgtctcgtaccgggcggtgtatctggaggagggcctcggccacgcc
ttcatcgcgctgcgggacgacaccgtggcggcctatctgaactcggcggagtacaacccg
ggcgccgagcacgagatcgaccccttcgacccggcgctcggcctgccctggcccacggac
ctggagtatctggtctcccagcgcgaccggaacgcccccgggctggccgaggccgaacgg
gcgggcctgctgccgtcctacgaggtctgccgggcgctgcacccccggcgtgactga

DBGET integrated database retrieval system