KEGG   Streptomyces violaceusniger: Strvi_3840Help
Entry
Strvi_3840        CDS       T01602                                 

Definition
formamidopyrimidine-DNA glycosylase catalytic domain-containing protein
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
svl  Streptomyces violaceusniger
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:svl03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4081620..4082408
Genome map
AA seq 262 aa AA seqDB search
MPELPDVEGFRRTLASCAQGHRVERVEVADAGVLHGVTAQRLKRDLEGRRFAAPRRHGKW
LIAPTDGPTVVVHFGMTGRLACGAESEPAGRFERVAFDLDDGHRLGYEDQRKLQGIWLAA
TEADVDRILGDQGPDALSLSRADLDRLLAGRRGRVKATLTDQAVIAGLGNLLGDEILWRA
RIHPQRPANALTDDEHERLHTAMREVLRASVRAGRVPDDPDWLTGQRDDPDPHCPRCGHP
LRRGRIAGRTSLWCPHCQRDGG
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagctaccggatgtcgaggggttccggcgaacgctggcctcctgcgcccagggc
caccgcgtcgagcgggtggaggtggccgacgcgggggtgctgcacggggtgaccgcgcag
cggctgaagcgcgatctcgagggccgccgcttcgccgcaccgcgccgccacggcaagtgg
ctgatcgcccccaccgacgggcccacggtcgtggtgcacttcggcatgaccgggcggctg
gcctgcggggcggagtccgaaccggccggccggttcgagcgcgtcgccttcgacctcgac
gacggccaccgcctcggctacgaggaccagcgcaaactccagggcatctggctcgccgcc
accgaagccgacgtcgaccggatcctcggcgatcagggcccggacgcgctctccctgagc
cgggccgatctcgaccggctgctggcggggcggcgcggacgcgtcaaggccacactgacc
gaccaggccgtgatcgccggactcggcaacctgctcggcgacgagatcctgtggcgggcc
cggatccatccgcagcggccggcgaacgcgctgaccgacgacgagcacgaacggctccac
accgcgatgcgcgaggtgctgcgcgcctcggtgcgggcggggcgggtgccggacgacccg
gactggctcaccggacagcgcgacgacccggacccgcactgcccccgctgcggccatccg
ctgcgccgcggccggatcgcggggcggaccagcctgtggtgcccccactgccagcgggac
ggcggctga

DBGET integrated database retrieval system