KEGG   Streptomyces violaceusniger: Strvi_4105Help
Entry
Strvi_4105        CDS       T01602                                 

Definition
pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
svl  Streptomyces violaceusniger
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:svl00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Strvi_4105
   00500 Starch and sucrose metabolism
    Strvi_4105
Enzymes [BR:svl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     Strvi_4105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4473853..4474956)
Genome map
AA seq 367 aa AA seqDB search
MTLSPRRPRRRRPASLIGSLALATGVGLVAAPAAGWLGGDARAHAATPAAAAATIVVAKD
GSGNYTTVQAAVDAVPANNPSAVTISVKPGTYRETVKVPANKPHIRLVGTTSGKNDVTIV
YNNASGTPKPGGGTYGTSGSATVAVEADDFQARNLQFVNDFNEANSAITDKQAVALRTAG
DRIVLDNIGTVGDQDTLLLDSASKSTVGRVYINNAWIQGNVDFIFGRASAVINKSAIRLV
KRYDGSSGGYVAAPSTAAGKKGFLFINSNITGDVGSRSFYLGRPWHAGGDASLDPQAIVR
NTDLSAAIKTTPWTDMSGFSWKDDRFGEYKNTGAGSGAASTDRPQLTDAQAADYEIADWL
GGWQPSA
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgaccctcagcccacggcgcccccggcggcgccgccccgcttcgctcatcggctctctg
gccctggccaccggcgtcgggctcgtcgccgccccggccgccggctggctcggcggcgac
gcccgggcccatgccgccacgcccgcggccgcggcggccaccatcgtggtggccaaggac
ggcagcggtaactacaccaccgtgcaggcggccgtcgacgcggtgccggccaacaacccg
tccgccgtcaccatctccgtcaagcccggtacgtaccgcgagacggtgaaggtccccgcc
aacaagccgcatatccggctggtgggcacgacgagcggcaagaacgatgtgacgatcgtc
tacaacaatgcctccggcacccccaagcccggcggaggcacctacggcaccagcggcagc
gcgaccgtcgccgtcgaggccgatgacttccaggcccgcaatctgcagttcgtgaacgac
ttcaacgaggccaacagcgccatcaccgacaagcaggcggtcgcgctgcgcaccgcgggc
gaccggatcgtcctggacaacatcgggacggtcggggaccaggacaccctgctgctggac
tccgcgagcaagtccaccgtcggccgggtgtacatcaacaacgcctggatccaggggaac
gtcgatttcatcttcggccgtgcctccgccgtcatcaacaagtcggcgatccggctcgtc
aagcgctacgacggcagctccggcggctatgtcgcggcgccctcgacggcggccgggaag
aagggcttcctcttcatcaacagcaacatcaccggggatgtcggcagccggtcgttctac
ctcggccgcccctggcacgcgggcggcgacgccagtctcgatccgcaggcgatcgtccgc
aatacggatctgtcagcggcgatcaagaccactccgtggacggacatgagcggcttctcc
tggaaggacgaccgcttcggggagtacaagaacaccggcgccggttccggtgcggcgagc
accgaccggccgcagctgaccgacgcccaggccgcggactacgagatcgccgactggctc
ggcggctggcagccgtcggcctga

DBGET integrated database retrieval system