KEGG   Streptomyces violaceusniger: Strvi_4207Help
Entry
Strvi_4207        CDS       T01602                                 

Definition
(RefSeq) pyridoxal-5'-phosphate-dependent protein beta subunit
  KO
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
svl  Streptomyces violaceusniger
Pathway
Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:svl00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Strvi_4207
Enzymes [BR:svl01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.15  D-cysteine desulfhydrase
     Strvi_4207
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4689780..4690799
Genome map
AA seq 339 aa AA seqDB search
MSEERQETTWRQETTRVELMSRPTPLEAAPRLARAIGLEPGDLWVKRDDLTGLGGGGNKV
RKLEWTAGAARAEGATTLVTSGAAQSNHARLTAAAGARLGMDVVLVLAGAPSEGMTGNIV
LDGLFGARVVWAGEVSEAELAAAVADVAGDLRAQGARPAVIPLGGSSVLGARGYAEAGTE
LLEQAPDLATAVVAVGSGGTMAGLVHALGAERVLGVHCGAIADPEHTVGHLVDGLAGRPA
ATSLRLRLDQVGPGYSALTEPVMDAITTAARTEGIILDPVYTGRALAGLIAAVHDGQVRP
GQRTVFLHTGGLPGLFGHTEALRRARSAVADTAVRWPRG
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
gtgtcagaagagcgtcaggagaccacgtggcgtcaggaaaccacgcgggtcgagctgatg
agtcggcccacaccgctggaggccgcgccgcggctggcccgggccatcgggctggagccc
ggtgacctatgggtcaagcgtgacgatctgaccgggctgggcggcgggggcaacaaggtc
cgcaagctggagtggacggccggggccgcccgcgccgagggcgccaccacgctggtgacc
agcggggccgcgcagagcaaccacgcccgcctgacggcagcggccggggcgcggctgggc
atggacgtggtccttgtcctcgccggtgcgccgagcgaggggatgaccggcaacatcgtg
ctcgacggtctcttcggcgcccgcgtcgtatgggcgggggaggtgagcgaggccgaactc
gcggcggccgtggcggacgtggccggggacctgcgcgcgcaaggcgctcggcccgcggtg
atccccttgggcggatccagcgtgctgggcgcccggggttatgccgaggcggggacggag
ctcctggaacaggccccggacctggccacggcggtcgtggcggtcggatcgggcggcacc
atggccggtctcgtccacgccctcggagccgagcgggtgctgggggtgcactgcggagcc
atcgccgatcccgagcacaccgtcggccacctggtcgacgggctggccggacggcccgcg
gccacgtccctgcggctgcgcctggatcaggtcggtcccggctactccgcgctcaccgaa
ccggtcatggacgccatcaccaccgcggcccgcaccgaaggcatcatcctcgaccccgtc
tacaccggccgtgccctggccggtctcatcgcggccgtccacgacgggcaggtgcgcccc
gggcagcgcacggtcttcctgcacaccggcggtctgcccggtctgttcgggcacaccgag
gcgctgcggcgggcgcgttccgccgtggccgacaccgccgtacggtggccccgcggctga

DBGET integrated database retrieval system