KEGG   Streptomyces violaceusniger: Strvi_4207Help
Entry
Strvi_4207        CDS       T01602                                 

Definition
pyridoxal-5'-phosphate-dependent protein beta subunit
Organism
svl  Streptomyces violaceusniger
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4689780..4690799
Genome map
AA seq 339 aa AA seqDB search
MSEERQETTWRQETTRVELMSRPTPLEAAPRLARAIGLEPGDLWVKRDDLTGLGGGGNKV
RKLEWTAGAARAEGATTLVTSGAAQSNHARLTAAAGARLGMDVVLVLAGAPSEGMTGNIV
LDGLFGARVVWAGEVSEAELAAAVADVAGDLRAQGARPAVIPLGGSSVLGARGYAEAGTE
LLEQAPDLATAVVAVGSGGTMAGLVHALGAERVLGVHCGAIADPEHTVGHLVDGLAGRPA
ATSLRLRLDQVGPGYSALTEPVMDAITTAARTEGIILDPVYTGRALAGLIAAVHDGQVRP
GQRTVFLHTGGLPGLFGHTEALRRARSAVADTAVRWPRG
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
gtgtcagaagagcgtcaggagaccacgtggcgtcaggaaaccacgcgggtcgagctgatg
agtcggcccacaccgctggaggccgcgccgcggctggcccgggccatcgggctggagccc
ggtgacctatgggtcaagcgtgacgatctgaccgggctgggcggcgggggcaacaaggtc
cgcaagctggagtggacggccggggccgcccgcgccgagggcgccaccacgctggtgacc
agcggggccgcgcagagcaaccacgcccgcctgacggcagcggccggggcgcggctgggc
atggacgtggtccttgtcctcgccggtgcgccgagcgaggggatgaccggcaacatcgtg
ctcgacggtctcttcggcgcccgcgtcgtatgggcgggggaggtgagcgaggccgaactc
gcggcggccgtggcggacgtggccggggacctgcgcgcgcaaggcgctcggcccgcggtg
atccccttgggcggatccagcgtgctgggcgcccggggttatgccgaggcggggacggag
ctcctggaacaggccccggacctggccacggcggtcgtggcggtcggatcgggcggcacc
atggccggtctcgtccacgccctcggagccgagcgggtgctgggggtgcactgcggagcc
atcgccgatcccgagcacaccgtcggccacctggtcgacgggctggccggacggcccgcg
gccacgtccctgcggctgcgcctggatcaggtcggtcccggctactccgcgctcaccgaa
ccggtcatggacgccatcaccaccgcggcccgcaccgaaggcatcatcctcgaccccgtc
tacaccggccgtgccctggccggtctcatcgcggccgtccacgacgggcaggtgcgcccc
gggcagcgcacggtcttcctgcacaccggcggtctgcccggtctgttcgggcacaccgag
gcgctgcggcgggcgcgttccgccgtggccgacaccgccgtacggtggccccgcggctga

DBGET integrated database retrieval system