KEGG   Streptomyces violaceusniger: Strvi_4330Help
Entry
Strvi_4330        CDS       T01602                                 

Definition
(GenBank) glycoside hydrolase clan GH-D
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
svl  Streptomyces violaceusniger
Pathway
svl00052  Galactose metabolism
svl00561  Glycerolipid metabolism
svl00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:svl00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Strvi_4330
  Lipid metabolism
   00561 Glycerolipid metabolism
    Strvi_4330
   00600 Sphingolipid metabolism
    Strvi_4330
Enzymes [BR:svl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Strvi_4330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Melibiase Glyco_hydro_36N Glyco_hydro_36C Glyco_hydro_31 Melibiase_2 Corona_5a
Motif
Other DBs
NCBI-ProteinID: AEM83979
UniProt: G2P4U0
Position
complement(4826939..4829074)
Genome map
AA seq 711 aa AA seqDB search
MPTISRAPDTGVWLLTTPRTSYALRIDETGAPCHLAWGPRLRLREAEELVVPAGEAASSF
EGRPAVGEELPVDGGTRYGTPSLQVRYADGSRAFEWQPTGHRVRTPSDGVRELSLEFRDR
HYPLRVALYYRVRDDTDVIERWTVLSNDGDQQLSLMRADSAAWSLPATADYRLSHVTGQW
SAESQLRREHLPYGETALTSRRGITSHHAAPWVMVDAGDATEEYGRVFGAALAWSGSWRI
TVQRTPDGRAGFSGGAGHEGTCVPLAPGEEFATPVFAGLFTDGGFGAASRAWHAYTLRHV
LPHGHEVAPVLYNSWEATGFDVDEANQKALAERAAALGVELYVVDDGWFGARRSDHAGLG
DWTPAQDRFPEGLGPLADTVHRLGMRFGIWVEPEMVNPDSDLYRAHPDWVLHTPGRARSE
LRNQLVLNFARDDVADWAYGWLTRLVTDHGIDFLKWDMNRAFSEAGWPGPPDGHDRLWTG
YVANLYGVLDRLRADHAGLRIETCSGGGGRVDLGILTRTDQAWVSDNTDAVDRLVIQHGF
GQLHPARTMSAWVTDVPHQLTSRTVPLRFRFHVAMCGLLGIGGDLARWSEAELAEGAELV
AEYKRVRHLVQHGALYRLSGPHGELPTVVQYAAEDAAETLVLAWQRGPRHGVPRLPVRLR
GLTPGARYRDTRTGEVHHATVLAEYGFHPDLRPGDWASTALHLVRVEQDDD
NT seq 2136 nt NT seq  +upstreamnt  +downstreamnt
atgccgacgatctcccgtgccccggacaccggggtctggctgctgaccactccccgtacg
tcatacgccctgcgtatcgacgaaacgggcgcgccctgccacctcgcatgggggccgcgg
ctaaggctgcgggaggcggaggagctggtcgtgcccgccggggaggcggcgagcagcttc
gagggacggcccgcggtgggcgaggaactgccggtcgacggcggcacccgctacggcacg
ccctccctccaggtccgctacgcggacggctcccgcgccttcgagtggcagccgaccgga
caccgcgtccgcacgccgtccgacggcgtccgcgaactctcgctggaattccgcgaccgc
cactacccgctgcgcgtcgccctgtactacagggttcgggacgacacggatgtcatcgag
cgctggacggtgctgagcaacgacggggaccagcagctcagcctgatgcgggccgactcg
gccgcctggtccctgccggcgacggccgactaccggctcagtcatgtcaccggccagtgg
tccgcggagagccaactgcgccgcgaacacctgccgtacggggagaccgcgctgaccagc
cggcgtggcatcaccagccaccacgccgctccctgggtgatggtggacgcgggcgacgcc
accgaggagtacggccgggtgttcggcgcggccctggcctggagcgggagttggcgcatc
accgttcagcgcacaccggacggacgcgccgggttctccggcggcgccggccacgagggc
acctgcgtgccgctcgcgccgggcgaggaattcgccacccccgtgttcgccgggctgttc
acggacggcgggttcggcgcggcgagccgggcctggcacgcgtacacactgcgccacgtc
ctgccgcacgggcatgaggtggcgccggtgctctacaactcctgggaggccaccggcttc
gacgtggacgaggcgaaccagaaggcgctggccgagcgggccgccgccctgggcgtggag
ctgtacgtcgtcgacgacggctggttcggggcccggcgcagcgaccacgcggggctcggc
gactggacccccgcccaggaccgcttccccgagggcctgggccccctggccgacacggtg
caccgcctgggcatgcgcttcggcatctgggtggagccggagatggtcaatcccgacagc
gacctctaccgcgcgcacccggactgggtcctgcacacccccggccgggcccgcagcgag
ctgcgcaaccagctcgtcctgaacttcgcccgcgacgatgtcgccgactgggcgtacggc
tggctgacccggctggtcacggaccacggcatcgacttcctcaagtgggacatgaaccgc
gccttcagcgaggccggctggcccggcccaccggacggccacgaccggctgtggacgggc
tatgtggccaatctgtacggcgtcctcgaccggctgcgggccgaccatgccgggctgcgc
atcgagacctgcagcggcggtggcggacgcgtggacctcggcatcctcacccgcaccgac
caggcgtgggtgtcggacaacaccgatgcggtcgaccgcctggtcatccagcacggcttc
ggtcagctccacccggcgcgcacgatgtccgcgtgggtgaccgacgtaccccatcaactc
acctcccgcaccgtgccgttgcggttccgcttccacgtggcgatgtgcgggctgctgggc
atcggcggcgatctggcccgctggtccgaggcggaactcgccgagggcgccgagctggtg
gccgagtacaagcgggtgcgccacctggtccagcacggcgccctgtaccggctgtccggg
ccgcacggcgagctgccgacggtggtgcagtacgccgccgaggacgccgccgagaccctg
gtactggcctggcagcgcggcccgcgccacggagtcccgcggctgccggtacggctgcgc
ggcctcacccccggcgcccgctaccgcgacacccgcaccggtgaggtgcaccatgccacc
gtgctcgccgagtacggattccacccggacctccggcccggcgactgggccagcacagcc
ctacacctggtcagggtggagcaggacgatgactga

DBGET integrated database retrieval system