KEGG   Streptomyces violaceusniger: Strvi_4446Help
Entry
Strvi_4446        CDS       T01602                                 

Definition
molecular chaperone GroES
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
svl  Streptomyces violaceusniger
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:svl00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Strvi_4446
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Strvi_4446
  Lipid metabolism
   00071 Fatty acid degradation
    Strvi_4446
  Amino acid metabolism
   00350 Tyrosine metabolism
    Strvi_4446
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Strvi_4446
   00626 Naphthalene degradation
    Strvi_4446
Enzymes [BR:svl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Strvi_4446
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4950297..4951385
Genome map
AA seq 362 aa AA seqDB search
MRAAVLTEFGAPLTVREIPDPGAGGGEVVVEVLAASVPPYADEVFSGRRNYPLEPPVVPG
PGGVGRVVGVGPDATRLRVGDLVWCDSTVRSRDDALTPDITLLGWSSRGEGGARLARHLH
DGSFAERMRVPTENVYPLPAEAGHNLARWSSLGVYTISYGGLLAGGLEAGETLLVSGATG
NLGSAAVATALAMGAGRVIAPGRNHAVLDLLVDRFGPRVRPVQLTGDEAADRAAMSAAAE
GPIDMVLDLLPPSAPSSVARAAAMTVREYGRVVLMGGVGMLGGADLALPYPWIMRNSVTL
RGQWMYPRAANVGMIRLIASGALDLDLERVRTFGLDAVNEAVTYAATHSGPFDRTVLTPP
AG
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgagagcagcagttctgacggagttcggtgccccgctcacggtgcgggagatacccgat
ccgggggcgggcggcggcgaggtggtggtcgaggtcctggcggcgagcgtcccgccgtac
gccgacgaggtcttcagcggccggcggaactacccgctcgaaccccccgtggtacccggc
cccggcggcgtggggcgggtcgtcggcgtcggcccggacgccacccggctgcgcgtcggc
gacctggtgtggtgcgacagcaccgtccgttcccgcgacgacgcgctgacccccgacatc
acgctgctgggctggagttcccgcggcgaaggcggcgccaggctcgcccgacacctgcac
gacgggtccttcgccgaacgcatgcgggtgccgacggagaacgtctaccccctgcccgcg
gaagcggggcacaacctggcgcgctggtcctcgctcggcgtgtacaccatttcctacggc
ggactgctggcgggcggactcgaagccggcgagacgctgctcgtcagcggggccaccgga
aacctcggcagcgccgccgtcgccactgcgctggccatgggggcgggccgggtgatcgcg
ccgggccgcaaccacgccgtgctcgacctgctcgtcgaccggttcggcccgcgcgtgcga
ccggtccaactgaccggcgacgaggccgccgaccgcgcggcgatgtccgccgcggccgag
ggtccgatcgacatggtgctcgacctgcttccgccttccgcacccagctcggtggcgcgt
gcggcggccatgaccgtccgcgagtacggccgcgtagtcctcatgggcggcgtcggcatg
ctcggcggtgcggacctcgcgcttccctatccgtggatcatgcgcaactcggtcaccctg
cgcgggcagtggatgtacccgcgcgccgcgaacgtcggcatgatccggctcatcgcgtca
ggtgcgctcgatctcgatctcgaacgggtccgcaccttcggactcgacgccgtcaacgag
gccgtcacctacgccgcgacgcacagcgggcccttcgaccgcaccgtcctcaccccgccc
gccggctga

DBGET integrated database retrieval system