KEGG   Streptomyces violaceusniger: Strvi_5148Help
Entry
Strvi_5148        CDS       T01602                                 

Definition
GMC oxidoreductase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
svl  Streptomyces violaceusniger
Pathway
Steroid degradation
Class
Metabolism; Xenobiotics biodegradation and metabolism; Steroid degradation [PATH:svl00984]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5713177..5714832)
Genome map
AA seq 551 aa AA seqDB search
MARSGDSAHHAAMTADLTRRHILGLAALQSAAALGLTRIGLTPAAAAQRADHFPAVVVGS
GYGAAVAALRLGEAGIRTLVVEMGRLWDTPGPDGRVHCSMTAPDQRSMWFKTRTEAPLST
FLWLDVINKDITPYPGVLDRVRFPGMSVYVGRGVGGGSLVNGGIAVTPSRSYFQQMLPQV
AADPMYDTYFPLANRMLGANTVPSAWFEATEWYTYARVARDQAARAGLKTVFMPNVYDFD
YMRREADGTATKSALAQEVIYGNNFGKRSLDKTYLAAALGTGQVTLHTLSRARALRRAPD
GSYVLTVERVDTTGTVVSTDEITCGSLFLGAGSLGTTELLLRARETGALPELSEEVGRGW
GGNGNVMLGRANHVWHPTGARQSTIPVMAIDDWSNTANPVFAEIAPLPAGLETWVSLYLA
ITRNPERATFTYDAAKDAAVLDWTRAQSAPSVAAAKALFDRVNYANATIYRYDLFGDTRA
IADDFCYHPLGGCVLGRATDPYGRVTGYDGLYVTDGSLIPGSIGVNPFVTITALAERTMA
RVLAEDRVGAR
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atggcgagatctggcgactccgcccatcatgccgccatgacagcagacctgacgcgtcgt
cacattctcggtctggccgccctgcagagcgcggcggccctcggactcacccgcatcggc
ctcaccccggcggccgccgcccagcgcgccgaccacttccccgccgtcgtcgtcggctcg
ggctacggcgcggccgtggccgcgctccggctcggtgaggcgggcatcagaaccctcgtc
gtggagatggggcggttatgggacaccccgggtcccgacggccgggtccactgttcgatg
accgcccccgatcagcgctccatgtggttcaagaccagaaccgaggcgcccctgtccacc
tttctgtggctggacgtcatcaacaaggacatcaccccctaccccggcgtcctggaccgc
gtccgcttccccggcatgtccgtctacgtggggcgcggggtcggcggcggttcgctggtc
aacggtggtatcgcggtcaccccgtcgcgctcgtacttccagcagatgctgccgcaggtg
gccgcggacccgatgtacgacacctacttcccgctggccaaccgcatgctcggcgccaac
accgtgccctccgcgtggttcgaggccacggagtggtacacctacgcccgcgtcgcccgc
gaccaggcggccagggcgggcctgaagaccgtcttcatgcccaatgtctacgacttcgac
tacatgcggcgcgaggccgacggaacggcgaccaagtccgcgctcgcccaggaggtcatc
tacggcaacaacttcggcaagcgcagcctcgacaagacctatctcgcggccgcgctcggc
accggccaggtcaccctgcacaccctcagccgcgcccgggccctgcggcgggcgcccgac
ggcagctatgtcctcaccgtggagcgcgtcgacaccaccggcaccgtcgtctccaccgac
gagatcacctgcggttcgctcttcctcggcgcgggcagcctcggcaccaccgaacttctg
ctgcgcgcccgtgagaccggcgccctgcccgagctgagcgaggaggtcggccggggctgg
ggcggcaacggcaatgtcatgctcggccgcgccaaccatgtgtggcacccgaccggtgcc
cgtcagtccaccatcccggtgatggcgatcgacgactggtccaacaccgccaacccggtc
ttcgccgagatcgccccgctgccggccggcctcgagacctgggtcagcctctacctcgcc
atcacccggaaccccgagcgcgccaccttcacctatgacgcggccaaggacgccgccgtg
ctcgactggacccgcgcccagagcgcgccgtccgtcgccgcggccaaggcgctcttcgac
cgcgtcaactatgccaacgccaccatctaccgctatgacctcttcggcgacacccgggcc
atcgccgacgacttctgctaccaccccctgggcggctgtgtcctgggccgggccaccgac
ccgtacggccgggtgaccggctacgacggcctctatgtgaccgacggatccctcatcccg
ggctccatcggcgtcaacccgttcgtcaccatcaccgccctggccgagcgcaccatggcc
cgggtgctggccgaggaccgcgtcggcgcccgctga

DBGET integrated database retrieval system