KEGG   Streptomyces violaceusniger: Strvi_5181Help
Entry
Strvi_5181        CDS       T01602                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
svl  Streptomyces violaceusniger
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:svl00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5747663..5749168
Genome map
AA seq 501 aa AA seqDB search
MVERYVMSIDQGTMSTRCILFDHQGRLVSVGQREHEQYFSKPGWAEHDPAEIWSHLRRVV
VPRALEGAGIRPEQIVAIGIANQRETTVVWDRRTGVPVCHAITWQDTRTSGYVEELRRTT
GDDFFLERCGLSPTTYFSAPRLRWLFDHVDGLRERAGRGDVLFGTMESWLIWNLTGGPDG
GLHLTDATNASRTMLMNIRSLTWDDELLAYFDVPRAMLPEIRPSAECYGMARALLPQVPI
CAALGDQQAALFGQTCFAGGEAKCTYGTGSFLLLNTGTELVRSRHGLLTTVGYKLGDEPT
VYALEGPIAVTGSLVQWFRDRLGMIHSAPEIETLARGVEDNGGCYIVPAFSGLFAPHWRS
DARGVIVGLTSYITKGHLARAVLEATGWQTREVVDAMNADSPQPLRQLKVDGGMTSNNLL
MQFLADVLDLPVVRPMVSETVSLGAAYAAGLASGYWPDLEGLRRNWHRAAQWMPTMDPAR
REAEYENWQRAVERSLGWARS
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggttgaacgctatgtgatgtccatcgaccagggcaccatgtccacccggtgcatcctc
ttcgaccaccagggacggctggtctcggtcggccagcgagaacatgagcagtacttctcc
aagcccggctgggccgagcacgaccccgccgagatctggtcccatctgcgccgtgtcgtc
gtgccccgggccctggagggcgcggggatccggcccgagcagatcgtggccatcggcatc
gccaatcagcgcgagaccacggtggtctgggaccggcgcaccggcgttcccgtgtgccac
gccatcacctggcaggacacccgcaccagcggctatgtcgaggagctgcggcggaccacc
ggtgacgacttcttcctcgaacgctgcggactctcccccacgacctacttctccgcgcca
cggctgcgctggctgttcgaccatgtcgacggcttgcgcgagcgcgcggggcgcggggac
gtgctgttcggcacgatggagagctggctgatctggaacctcaccggcgggcccgacggc
gggctgcacctcaccgacgccaccaacgccagccgcaccatgctgatgaatatccgcagc
ctgacctgggacgatgagctgctggcctatttcgatgtgccgcgggcgatgctgccggag
atccgcccctccgccgagtgctacggcatggcccgcgccctgctgccgcaggtgccgatc
tgcgccgcgctcggcgatcagcaggcggcgctgttcgggcagacgtgtttcgccggcggc
gaggcgaagtgcacctacggcaccggcagcttcctcctgctcaacaccggcaccgagctc
gtacggtcccggcacgggctgctgaccacggtgggctacaagctcggcgacgagccgacg
gtctacgccctggagggcccgatcgccgtcaccggctcgctggtgcagtggttccgggac
cgcctgggcatgatccacagtgcccccgagatcgagaccctggcccgcggcgtcgaggac
aacggcggctgctacatcgtccccgccttctccgggctcttcgccccgcactggcgcagc
gacgcgcgcggagtgatcgtcgggctcacctcgtacatcaccaagggacatctggcccgg
gccgttctggaggccaccggctggcagacccgggaggtggtcgacgccatgaacgccgac
tcgcctcagccgctgcggcagctcaaggtggacggcgggatgacgtcgaacaatctgctg
atgcagttcctggccgatgtcctggacctgcccgtggtgcgccccatggtctccgagacc
gtctccctcggggccgcctacgccgccgggctcgcctccggctactggcccgacctggag
gggctgcgccgcaactggcaccgcgcggcccaatggatgcccacgatggaccccgcccgg
cgggaggcggagtacgagaactggcagcgggcggtcgagcggtcgctgggctgggccagg
tcgtag

DBGET integrated database retrieval system