KEGG   Streptomyces violaceusniger: Strvi_5710Help
Entry
Strvi_5710        CDS       T01602                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
svl  Streptomyces violaceusniger
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:svl00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6502804..6504336
Genome map
AA seq 510 aa AA seqDB search
MPQPTDTYVAAIDQGTTSSRCIIFDHDGAIVAVDQREHRQIFPKPGWVEHDATEIWAKVQ
AVVAGARAKAGLRADQLTALGITNQRETTVLWDRRTGKPVHNAIVWQDTRTSGLCDELGG
EVGQDRFRDTTGLPLASYFSGPKAAWLLEHVPGLRHRAELGEIAFGTIDSWLIWNLTGGT
DGGVHVTDVTNAGRTLLMDLRTLQWDTSILAAMGLPEAMLPEIRSSAEVYGAAVGQLAGV
PVASALGDQQAAVFGQTCYGVGEAKNTYGTGSFLLLNTGDRPVPSKSGLLTTMGYQLGGE
RPVYCLEGSIAITGALVQWFRDQLGIIRSADEIEPLAASVDDNGGAYIVPAFSGLFAPYW
RSDARGVITGLTRYVTKGHLARAVLEATSWQTREVVDAMYQDSGVRISSLKVDGGMTANS
LLMQHQADVLGVPVIRPVVAETTCLGAAYAAGLATGAWQDLDELRAHWKRDTEWTPGMSE
EERTREYGNWRMAVERSFGWHKEEQRAEGS
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgccgcagccgacggacacctacgtcgccgcgatcgaccagggcaccacctccagccgc
tgcatcatcttcgaccacgacggcgccatcgtcgccgtcgaccagcgcgagcaccgtcag
atctttcccaaacccggctgggtcgagcacgacgccaccgagatctgggccaaggtgcag
gccgtggtggccggtgcgcgggccaaggcggggctgcgggccgaccagctcaccgcgctg
ggcatcaccaaccagcgcgagacgacggtcctgtgggaccgccgcaccggcaagccggtg
cacaacgcgatcgtctggcaggacacccgcacctccggcctgtgcgacgaactcggcggc
gaggtgggacaggaccgtttccgggacaccaccggactgccgctcgccagctacttctcc
gggcccaaggccgcctggctgctggaacacgtccccgggctgcgccaccgtgccgagctg
ggcgagatcgccttcggcaccatcgactcctggctgatctggaacctcaccggcggcacc
gacggcggagtgcacgtcaccgatgtgaccaacgccggacgcacactgctgatggatctg
cggaccctccagtgggacacctcgatcctggccgccatgggcctgcccgaggcgatgctc
ccggagatccgctcctccgccgaggtgtacggcgcggcggtcgggcaactggccggtgtg
ccggtggcctccgcgctcggcgatcagcaggccgccgtcttcggccagacctgctacggc
gtcggcgaggccaagaacacgtatggcaccggcagcttcctgctgttgaacaccggtgac
cgcccggtgccgtccaagagcgggctgctgaccacgatgggctaccaactcggcggtgag
cggcccgtctactgcctggagggatcgatcgcgatcaccggcgcgctggtgcagtggttc
cgcgatcagctcggcatcatccgctccgccgacgagatcgagccgctcgccgcgagcgtg
gacgacaacggcggggcctacatcgtcccggccttctcgggtctgttcgccccgtactgg
cgctcggacgcccgtggcgtgatcaccggcctcacccgctatgtcaccaaggggcatctg
gcccgtgccgtcctggaggcgaccagctggcagacgcgcgaggtggtcgacgcgatgtac
caggactccggggtgcggatcagctcgctcaaggtcgacggcggaatgacggccaacagt
ctgctgatgcagcatcaggccgatgtgctgggcgtcccggtgatccgcccggtggtcgcc
gagaccacctgcctgggcgcggcgtacgcggcggggctggccaccggcgcctggcaggac
ctcgacgagctgcgggcccactggaagcgggacaccgagtggaccccggggatgtccgag
gaggagaggacgcgcgagtacggcaactggcgcatggcggtggagcgcagcttcgggtgg
cacaaggaagagcagcgggccgagggctcctga

DBGET integrated database retrieval system