KEGG   Streptomyces violaceusniger: Strvi_5822Help
Entry
Strvi_5822        CDS       T01602                                 

Definition
glycoside hydrolase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
svl  Streptomyces violaceusniger
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:svl00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Strvi_5822
  Lipid metabolism
   00561 Glycerolipid metabolism
    Strvi_5822
   00600 Sphingolipid metabolism
    Strvi_5822
Enzymes [BR:svl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Strvi_5822
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6649034..6651091
Genome map
AA seq 685 aa AA seqDB search
MRHRCFRPSKRRVIGALSAGLLATAGLALPAVAQPSHPAEVTTPASAPSAAPGDGLALTP
PMGFNNWNSTHCRAEFNEAMVKGIADIFVAKGLKDAGYQYVNLDDCWALPQRDADGKLVP
DPVRFPNGIKAVADYAHSKGLKIGIYTSAGTKTCNTAGFPGALGHEKSDAQQFADWGIDY
LKYDNCNNQGVDAKQRYRAMRDALKAASESTGHPIVYSICEWGENKPWEWAGEFGQLWRT
TGDISDSWGSMLSIAKQNLPLAQYAGPGHWNDPDMLEVGNGGMTDTEYRSHFSLWSIMAA
PLLIGTDLRKATDETYEILGNREVIGVDQDPLGKQGTVVSSEGGRWVIAKEMADGSRAVA
LFNETDRPQHIATTATGVGLPKATAYRLRDLWSHKDYNTAGAISATVPAHGTVLYRASAD
ARWASYPPLAELGIDGTALTEAGDTAQVVTTLTDLGRTPAHQVSVRLTGPDGWRIKATSP
TRAASLPTGSKLATRWQVTAPAGSAPGAYDLTVAADYRSPKGAKAAARLVSAVHVVVAPP
SGSSYASDLSWLSALNGWGPVEKNTSVGESGAGDGHPLTLGGTTYDKGLGVHAPSEVTYY
TGGRCSRFTAQVGVDDEEGTEGSVAFEVWADDTKVASSKTLTNADPATALDAAIGKANTV
RLVVTDGGDGVTSDHGDWADASFTC
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
gtgcgccaccgctgttttcgcccctcgaagcgaagagtcatcggagcattgagcgccggc
ctgctggcaacggccggcctggccctcccggccgtcgcccagccgtcgcaccccgccgag
gtcaccacaccggcctccgcgccgagcgccgcgcccggtgacgggctcgccctcacccct
ccgatgggcttcaacaactggaactccacccattgccgcgccgagttcaacgaggcgatg
gtcaagggcatcgccgatatcttcgtggcgaaggggctgaaggacgccggataccaatac
gtcaacctcgacgactgctgggcgctgccgcagcgcgacgcggacggcaagctggtcccc
gacccggtccgctttccgaacggcatcaaggccgtcgccgactatgcccactccaaggga
ctgaagatcggcatctacaccagcgcgggcaccaagacctgcaataccgccggcttcccc
ggggccctcggccatgagaagtccgacgcccagcagttcgccgactggggcatcgactac
ctcaagtacgacaactgcaataaccagggtgtcgacgccaagcagcgctaccgcgccatg
cgcgacgcgctgaaggcggcgtccgagtccaccggccaccccatcgtctacagcatctgc
gaatggggcgagaacaagccatgggagtgggccggtgaattcggccaactgtggcggacg
acgggcgacatcagcgacagctggggcagcatgctgtcgatcgccaagcagaacctgccg
ctcgcgcagtacgccggacccggccactggaacgaccccgacatgctggaggtcggcaac
ggcgggatgacggacaccgagtaccgcagccacttctcgctgtggtcgatcatggccgca
cccctgctgatcggcaccgatctgcgcaaggccaccgacgagacctatgagatcctcggc
aatcgcgaggtcatcggcgtcgatcaggacccgctcggcaagcagggcaccgtggtctcc
tccgagggcggtcgctgggtcatcgccaaggagatggcagacggcagccgcgccgtcgcc
ctgttcaacgaaaccgaccggccgcagcacatcgccaccacggcgaccggggtcgggctg
ccgaaggcgaccgcgtaccggctgcgcgacctgtggtcgcacaaggactacaacaccgcc
ggagccatttcggctaccgtcccggcccatggcaccgtgctctaccgggcctcggccgac
gcgcgctgggcctcctacccgcccctcgccgaactcggcatcgacggcaccgcgctgacc
gaggccggggacaccgcccaggtcgtcaccaccctcaccgacctcggccgcaccccggcc
catcaggtctcggtccgcctcaccggccccgacggctggcggatcaaggccacctccccg
acccgggccgcctcgctgcccaccggctcgaagctggccacgcgctggcaggtcaccgcg
cccgccgggtccgcacccggtgcgtacgatctgacggtcgccgccgactaccgctcaccg
aagggcgccaaggccgccgcgcggctggtctcggcggtccatgtggtggtcgcaccgccc
tcgggcagctcgtacgcgagcgatctgtcctggctgagcgcgctcaacggctggggcccg
gtggagaagaacaccagcgtcggcgagagcggggcgggtgacggccacccgctcaccctc
ggcggcaccacgtacgacaagggcctgggcgtgcacgcccccagcgaggtcacctactac
accgggggccggtgctcgcgcttcaccgcgcaggtcggcgtggacgacgaggagggcacc
gagggatcggtcgccttcgaggtctgggcggacgacaccaaggtggcgtcgtccaagaca
ctgaccaacgccgatccggccaccgcccttgacgccgccatcggcaaggcgaacacggtc
aggctcgtcgtcaccgacggcggggacggggtcaccagcgaccacggggactgggccgac
gcgtccttcacctgctga

DBGET integrated database retrieval system