KEGG   Streptomyces violaceusniger: Strvi_6935Help
Entry
Strvi_6935        CDS       T01602                                 

Definition
class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
svl  Streptomyces violaceusniger
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:svl00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7948945..7949631)
Genome map
AA seq 228 aa AA seqDB search
MTQSRTTRQPQPRLTHPLRQAWTQVVRTARRTTADGLVVGTSGNVSARVGDTVLVTPSGV
PYDRLGPRDAVAVDLDGQQVLGTLEPTSELPMHLAVYRETDAEAVVHTHAVHATAVSTLV
DELPAIHYMTAALGGPIRVAAYALYGTDELADAMVEALRDRSACLLRNHGTVVHGATLDQ
AFDRTAQLEWMCRVWLTAVSVPGRTPTLIPPDELRRAADKLSGYGQPS
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
gtgacccagtcgcgaaccacgcggcagccgcagccgcggctgacccatcccctgcggcag
gcatggacgcaggtggtgagaacggcccgcagaaccaccgcggacggcctggtcgtcggc
acctcgggcaatgtctcggcccgggtcggcgacaccgtcctggtgaccccgagcggcgtc
ccctacgaccggctcggcccacgggacgccgtcgccgtcgacctcgacggacaacaggtc
ctcggcacgctcgagcccaccagcgagctgcccatgcacctggccgtctaccgggagacc
gacgccgaggccgtggtccatacccacgccgtccacgccacggccgtctccacgctcgtc
gacgagctccccgcgatccactacatgaccgcggccctcggcggaccgatccgcgtcgcg
gcctacgcgctctacggaacggacgaactggccgacgccatggtcgaggcgctgcgcgac
cgcagcgcctgtctgctgcgcaaccacggcaccgtcgtccacggcgccaccctggaccag
gcgtttgaccgcaccgcccagctcgaatggatgtgccgggtctggctcaccgcggtctcc
gtccccggccgcacccccaccctgatcccgccggacgagctgcggcgcgccgcggacaag
ctcagcggctacggccagccgagctga

DBGET integrated database retrieval system