KEGG   Streptomyces violaceusniger: Strvi_6940Help
Entry
Strvi_6940        CDS       T01602                                 

Definition
cobaltochelatase subunit
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
svl  Streptomyces violaceusniger
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:svl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Strvi_6940
Enzymes [BR:svl01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Strvi_6940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7954708..7956858
Genome map
AA seq 716 aa AA seqDB search
MTTTYPFSAIVGMDGLRLALLLNAVSPAVGGVLVRGEKGTAKSTAVRAIAALLPAVDVVA
GCRFSCDPAAPDPSCPDGPHEPDTGEARPARMVELPVGASEDRLVGALDIERALSDGVKA
FEPGLLADAHRGVLYVDEVNLLHDHLIDLLLDAAAMGASYVEREGVSVRHAARFLLVGTM
NPEEGELRPQLLDRFGLTVEVAASRDTDERVEVVRRRLAYDEDPEGFAARWAADEAALRE
RIAAARALLPRVGLGDRALRQIAAVCAGFEVDGMRADIVTARTATALAAWADRTDVRTED
VRGAALLSLPHRRRRAPFDAPGLDEDKLDEILRQFEEDEPEPDPDAGPEGPDSPDDGPDG
PGGPENPGGGPQEGAGDGAGEQAPPAAPEPSVPDQRTGEHETADRETDSARADGDGGAGE
SAEGTGGSGGERAAVGAAAPFRTRRLDVPGLGEGAAGRRSRARSAHGRTTGARRPRGTLS
ALHLTATVRAAAPHQRARGRRGPGLLVRRDDLREAVREGREGNLVLFVVDASGSMAARTR
MSAIKGAVLSLLLDAYQRRDKVGLITFRGADAELALPPTSSVDAAAVRLERLPTGGRTPL
AAGLLKAREVLRVERLRDPSRRPLLVVVTDGRATEAKRAGGPTPVERAGRAARMLAGDGV
ASVVVDCESGPVRLGLAGALARELRATPVTLDELRADSVTALVRDVRTVSNPRRAA
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaccacctaccccttcagcgcgatcgtcggcatggacggtctgcggctcgccctg
ctcctcaacgccgtctcacccgccgtgggcggcgtcctggtgcgcggggagaagggcacg
gccaagagcaccgccgtaagagcgatcgcggcgctgctgcccgcggtcgacgtggtggcc
gggtgccggttctcctgcgatccggcagcgcccgacccgtcctgcccggacggcccccat
gagccggacaccggcgaggcgcgccccgcgcgcatggtcgaactgcccgtgggcgcctcc
gaggaccggctggtcggcgccctcgacatcgagcgggcgctgtcggacggggtgaaggcg
ttcgagcccggactgctcgcggacgcccaccgcggggtgctctacgtcgacgaggtcaac
ctgctccacgaccatctgatcgacctgctgctcgacgcggccgccatgggcgcctcctac
gtggagcgcgagggggtgtccgtacggcatgcggcgcgcttcctgctggtgggcaccatg
aacccggaagagggcgagctgcggccgcagttgctggaccgcttcggtctcacagtggag
gtcgcggcgtcccgggacaccgatgagcgggtcgaggtggtgcggcggcggctggcctac
gacgaggaccccgaggggttcgcggcgcgctgggcggcggacgaggccgccctgcgggag
cgcatcgcggcggcgcgcgccctgctgccgcgggtggggctgggcgaccgcgcgctgcgc
cagatcgcggcggtgtgcgccgggttcgaggtggacgggatgcgcgcggacatcgtgacg
gcccgtacggcgaccgcgctggccgcctgggcggaccggaccgatgtgcggaccgaggac
gtacggggggcggcgctgctgtcgctcccccaccgccggcggcgggctccgttcgacgcg
ccggggctcgacgaggacaaactcgacgagatcctgcggcagttcgaggaggacgagccg
gagccggatccggacgcgggcccggagggccccgacagcccggacgacgggccggacggc
ccgggcggccccgagaaccccggcggcgggccccaggagggcgcgggcgacggggcaggg
gagcaggcgccgcccgccgcgcccgagccgtccgtccccgaccagcgcacgggtgagcac
gagacggccgaccgcgagaccgactccgcccgggccgatggcgacggcggggcgggggaa
tcggccgaaggtactggcggatccggcggtgagcgggcggccgtgggcgccgccgccccg
ttccgcacccggcggctcgacgtccccggtctgggcgagggcgcggccgggcgccggtcg
cgcgcccgcagcgcgcatggccgcaccaccggggcgcggcgcccgcgggggacgctctcc
gcgctgcatctgacggcgaccgtccgggcggccgccccgcatcagcgggcgcgcgggcgg
cgcggtcccgggcttctggtgcgccgggacgatctgcgcgaggcggtgcgcgagggccgg
gagggcaatctcgtgctgttcgtggtggacgcgtcgggctcgatggccgcgcggacacgg
atgagcgcgatcaagggcgcggtgctgtcgctgctgctggacgcctaccagcggcgggac
aaggtcgggctgatcaccttccggggcgcggacgccgagctcgcgctgccgcccacctcg
tcggtcgacgcggccgccgtgcggctggaacggctgccgaccggcggccgtacgcccctg
gcggccgggctgttgaaggcccgggaggtgctgcgggtggagcggctacgggatccctca
cgccgcccgctgctggtcgtggtgaccgacgggcgggccacggaggcgaagcgggccggc
gggcccacgccggtcgagcgggccgggcgcgcggcgcggatgctcgcgggcgacggggtc
gcctcggtggtggtggactgcgagtcggggccggtgcggctgggactggcgggcgcgctc
gcccgcgaactgcgggccacgccggtgacgctcgacgagctgcgcgcggacagcgtgacc
gcactggtgcgcgatgtacgaaccgtatcgaaccctcggagggccgcctga

DBGET integrated database retrieval system